SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC010102 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC010102
Domain Number 1 Region: 255-483
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.86e-28
Family Pectate transeliminase 0.078
Further Details:      
 
Domain Number 2 Region: 508-696
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.99e-26
Family Pectin methylesterase 0.055
Further Details:      
 
Domain Number 3 Region: 652-814
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.09e-20
Family Pectate lyase-like 0.051
Further Details:      
 
Domain Number 4 Region: 152-235
Classification Level Classification E-value
Superfamily F-box domain 2.49e-17
Family F-box domain 0.0018
Further Details:      
 
Weak hits

Sequence:  TC010102
Domain Number - Region: 820-889
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0612
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC010102
Sequence length 915
Comment GLEAN_10102
Sequence
MPSASFTASRSYVRRSRRKGANRIPTPSRTTSASQSHANLPVLYLTKTFQHLRRPLRALG
GPSAMAPGTSGGAIPAHHSPYDLRRKSPSHHDGPGPSTSAATAGSPTSPATPTAPAQGYT
SAMLPARKRPRRTCSASYENCTNTAAHYLQYELPDEVLLTIFNYLLEQDLCRVSQVCKRF
QAIANDTEIWKRLYQSVYEYDLPLFNPAPCVFQFISPEESDLANPWKESFRQLYRGIHVR
PGYQDLTFKGRNLVYFNTIQAALDYADERSGSALIFLHAGTYRGEFLVIDDSDIALIGAA
PGNVAESVILERESESTVMFVEGAKNAYCGHLTLKFSPDVTSTVPHHKHYCLEVGENCSP
TIDHCIIRSTSVVGAAVCVSGAGANPVIRHCDISDCENVGLYVTDFAQGTYEDNEISRNA
LAGIWVKNNANPIMRRNHIHHGRDVGIFTFDSGMGYFEANDIHNNRIAGFEVKAGANPTV
VQCEIHHGQTGGIYVHENGLGQFIDNKIHSNNFAGVWITSNSNPTIRRNEIYNGHQGGVY
IFGEGRGLIEHNNIYGNALAGIQIRTNSDPIVRHNKIHHGQHGGIYVHEKGQGLIEENEV
YANTLAGVWITTGSSPVLRRNRIHSGKQVGVYFYDNGHGKLEDNDIFNHLYSGVQIRTGS
NPVIRGNKIWGGQNGGVLVYNGGLGLLEQNEIFDNAMAGVWIKTDSNPTLKRNKIFDGRD
GGICIFNGGKGILEENDIFRNAQAGVLISTQSHPILRRNRIFDGLAAGVEITNNATATLE
SNQIFNNRFGGLCLASGVQPIVRGNKIFNNQDAVEKAVANGQCLYKISSYTSFPMHDFYR
CQTCNTTDRNAICVNCIKTCHAGHDVEFIRHDRFFCDCGAGTLTNQCQLQGEPTQDTDTL
YDSAAPMESHTLMVN
Download sequence
Identical sequences TC010102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]