SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC010384 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC010384
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-34
Family Kelch motif 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC010384
Sequence length 160
Comment GLEAN_10384
Sequence
MRSAEVFDIKTNQWSYIPQMISARSGVSLVVYDNTLYALGGFNGYVRLTSGEKYVPGESP
WWTEISEMMTPRSNFATVILDDYIYVIGGFNDNFVSGSSTINFVEYYDPEADDWYDASPM
NLNRSALSACVISGLPNTKDYSILGRSQQEWGQGAEIGSN
Download sequence
Identical sequences TC010384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]