SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC010540 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC010540
Domain Number 1 Region: 744-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 2 Region: 847-893
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family Laminin-type module 0.00097
Further Details:      
 
Domain Number 3 Region: 278-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.084
Further Details:      
 
Domain Number 4 Region: 955-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 5 Region: 460-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 6 Region: 902-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.0018
Further Details:      
 
Domain Number 7 Region: 413-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000206
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  TC010540
Domain Number - Region: 358-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 1003-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000271
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 800-849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000301
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number - Region: 707-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000753
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC010540
Sequence length 1635
Comment GLEAN_10540
Sequence
MRCQVPLTVFVLCVFGHAGGQEADITPVIGRKGTRCYDKFNKPQRCIPEFENAAFNVLME
ATNTCGEHGKTEYCVQSGVTGLRKSCEVCYPNDHQARYLTDFHNQDQPTWWQSETMYEGI
QFPNQVNLTLKLGKAFDITYVRLWYYSPRPESFSIFKKTAENGSWIPYQYYSATCRDTYG
LPDTQHTTRGEETRALCTSEYSDISPLRGGNVAFSTLEGRPSAYNFEASPELQEWVTATD
IMIVLDRLNTFGDEVFGDQQVLRSYFYAVADVAVGARCKCNGHASECITSTGVDGSRRRV
CKCEHNTAGPDCNECLPFYNDAPWKRATARDAHECKLVKEAESTQWDGLKPWFSGSQCNC
NGFSNRCYYDEELYRLTGHGGHCLDCTANRDGPNCERCRENYYMREDGYCIACECNEKGS
RSLQCNAEGKCQCKPGVTGDKCDRCAVNYYEFSATGCKSCGCSEAGSVNNEPNCDPYTGV
CYCKENVEGRRCRECKPGFFNLDKDNEFGCTPCFCYGHSSECYSARNYAKHLIDSVFSRS
TERWQAEDEYGRDVEIEHVPLAHSIKAEARGDETVYFLANERFLGERRFSYNQLLQFSLW
IGDYDRPIPTATDIILEGGGASVTNTIFAQQNKIPTNTKQKYSFRLHEHPNYGWQPRLSA
RAFMSLLDNITAIKIRATYAPQGVGFLTDVKLETAAQKVAGPPALWVEQCVCPNGYVGYF
CESCKPGYRHFPSLGGRFMPCILCDCNQHAQICDSETGRCICEHNTAGENCEFCARGYYG
NALGGTPDDCKPCGCPDGGACIQVDEDIIMCTECPVGHTGHKCDSCSDGYFGDPTGRFGP
RQPCTQCDCNLNIDPNGIGNCNTTTGECLKCIHNTGGPKCEVCLPGYYGNALALPKGDCQ
PCECNPAGTESNGGSIECDRITGSCHCRPHVIGRNCDQCEDGYFNLRSGEGCHSCNCDPI
GSYNQTCNVYTGQCFCRPGITGLRCDHCEPFKYGFSSEGCKECECDKIGSRDHQCDPSGQ
CPCLDNVEGRRCDRCKENKYDRQRGCIDCPECYNLVQDASKEHQEKLSKLSDILDEIERR
PTVIDDDEFPTELEKLQTNIDAFHEKVKNATGENSIIQQVRDIRNREKEISRTLSAIDEN
VYLANEKATAAEHNIENTDNLLAETEDKLNDAFEDLDVRGRKALDSAWKRAQIVGQQSDR
MTQIAHEAREIADQLDADADALTQKANEAKNKSNEAYEIAKNAIRKQNNVSETERQIRSE
LVNTEIKLNKTKEWTQEVSDRARETKKDALALLNEVTNLVIPEIDIPKLKEKAKRVKQEA
LQLRNDTNKILSESNKLLVEIDEQLFRGREQLDRANIQQDDTADLLQEIYLYKSHAEAAV
KMGNNILNSTKETYKILTHFDKQVQDSRAASEEALKEVDEIQEMIDDAFDKATDAELTLR
EAKGNADAALKRALQANELAKNASANAENIKNDADLLFQNASGLNEEADLMADRVEATQS
ALRTLIQETRSNDTLINQAKEKVGRAGKETEEVSKKVSDLTKNVQSILAELGNLPQIDDN
ELDVLEKELRKAEEKVNEAKLDEKLNDLREKQKGQNDLINFYKTQIDQLQREVENVEQIA
KALPDGCFKRLELEP
Download sequence
Identical sequences TC010540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]