SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC010807 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC010807
Domain Number 1 Region: 357-415,447-641
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 9.61e-38
Family TehB-like 0.094
Further Details:      
 
Domain Number 2 Region: 87-203
Classification Level Classification E-value
Superfamily ARID-like 1.29e-31
Family ARID domain 0.00057
Further Details:      
 
Domain Number 3 Region: 296-355
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.99e-16
Family PHD domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1142-1221
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000399
Family PHD domain 0.0077
Further Details:      
 
Domain Number 5 Region: 1454-1536
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000598
Family PHD domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC010807
Sequence length 1573
Comment GLEAN_10807
Sequence
MTTKVDKPTSPTKNHAKNTSPKQDSGCGYKEECFEFEPPPEAPVFHPTEEEFNDPLEYIN
KIRKYAEGSGICKIKPPPNWQPPFAVDVDKLRFTPRIQRLNELEAKTRVKLNFLDQIAKF
WELQGSTLKIPMVEKRCIDLYTLHSIVQSQGGFDQVTKDRKWSKISVSMGYPSGKSIGTI
LKTHYERLLYPFDLFKQGKTLNFKMTSPLNEESEKADKDYKPHGIVGRMAIKPPPEKHAR
RSKRFDADPRVEDDVKEDCKDDNKELKRLQFYGAGPKIAISKDKDDDKRNNKTVNYDFDP
LAKYVCHNCNRGDSEEYMLLCDGCDDSYHTFCLMPPLNEIPKGDWRCPKCVAEEVSKPME
AFGFEQAQREYTLQQFGDMADQFKSEYFNMPVHMVPTNVVEKEFWRIVSSIDEDVTVEYG
ADLHTMDHGSGFPTKTSLNLLPGDKEYADSGWNLNNLPVLENSVLGYINADISGMKVPWM
YVGMCFATFCWHNEDHWSYSINYLHWGEAKTWYGVPGKMAEAFEETMKSAAPELFQSQPD
LLHQLVTIMNPNILMKAGVPVFRTDQHAGEFVVTFPRAYHAGFNQGYNFAEAVNFAPADW
LRMGRECILHYSNLRRFCVFSHDELVCKMALDPDKLGLTIAAATYQDMLQMVETEKTLRK
TLLDAGVSNAEREAFELLPDDERQCDHCKTTCFLSAVTCKCSPDILVCLRHYKNLCNCNP
ENYTLRYRYTLDELPVMLKSLKLKAESFDHWVNRVKDALDPKTPKTLTLQELKALLNEAD
GKKFPKCDLLQTLTDAVEDAEKCARVIQQLDLNKMRTRTRNSSDTKYKLTLKELILFHEE
LDSLVCVLEEAKSIKDLLEETKKFETTSKALLEMKLSECSLSDLEQCISQGNNLCIELPN
LRSVKMRLRQCVWLNDVLSYKKKTEVLGLESIKNIIKTGTQLPPNPEIEVELSELQALLS
KSEEWEEKAQAILKDTGSEVLIEVDKLLKEAGQINSYLPSEEFLFEAMDKSRDWLRQLEE
MNSAECYPYFNDMEELIKRGHQLALHLVEVSKLESFLETANAWKEKTSRAFLRKNSSCTL
MEALSPRIQFNSNSKCRKKNQEDEHGIFNLTSDMDPATVVALFKDAEQNEMELIRAVRAA
NLEKSMDPNDCASFCVCGRSLFGLMMQCELCKDWFHSNCVPLPKVASSKYKGNFTSVALH
LGFKDCKFLCPNCYRTKRPRLDAILLLLMSLQKLFVRVPEGEALQSLTERAMNWQDRARQ
LIQQPELEAAKNKLASFSQKYSEAAARQRTEKIISSELKRAYKNPDLLQRVQEIAPFSGV
TPDDKSDDTNITDSSDDSKGYGSADDRMGEHAYSLHFPKFDSGEYKLQIASDIRKQIEEL
LMEGDLLEVYLDETFQLWKLLQASRDPEKEAILIDFDMNSKTAPSKRGRKRRSDEVEMMK
KSKLVKDENKKSKPKTKETQGKKEGTRRKGRRRQSTGSEDEDEDSCAAPGCLKPSGENVD
WVQCDGGCDKWFHMACVGLSAQDICEDEDYICMTCSQNAYGTLNAVDSFSSISSDCSTLS
QPSTSKDSVQCKF
Download sequence
Identical sequences D6W7J7
XP_008199370.1.52716 TC010807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]