SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC010820 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC010820
Domain Number 1 Region: 123-373
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 9.75e-51
Family TehB-like 0.071
Further Details:      
 
Domain Number 2 Region: 3-67
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.4e-16
Family PHD domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC010820
Sequence length 841
Comment GLEAN_10820
Sequence
MEASYCLCGQPYDPNIFMIQCDACKDWFHSSCCNFQEHLAIEIDKYHCPKCAPIFGPSIY
KPYRNWHRHDYWDEDATTKPVQTGTGVFIRELLARHFASEGEVVVHMRGQQITETLLQQQ
GFNNPIVVDGKDGLDMTLPPDNFSLYDVESYVGGDMEIDVIDVTRQCNIKMKLRDYVEYY
NSLNRTRVFNVVSLEFSKTALAPLVEAPSIARKLDWANIVWPRDFPLERPQVQKYCLMSV
KDSYTDFHIDFGGTSVWYHVLRGEKIFYLIRPTPANLTLYQQWMTSSNQSETFFGDQVDR
CYKCILRQGQTMMIPTGWIHAVLTPIDSLVFGGNFLQSLNIPMQLAVYDIEKKVKTDAKY
RYPNFELINWFAASHLLKKISELNSEDRKCPNHLLVGLKTLLITLKQWNSEKDYNTSVRD
QIPYTINPVQLLKDMSREIRHAERIINQLNPPKPERESKRKRRRPINRDFVDYSLSPKSS
AQDFISETKDYARQPPLKLSLPKPVTYPYDRPNFMEQRINVEEQSWLSPQFSRPEQTTAI
HRGGAVLKFKLGSKDILPHSHADDIPEEQFDFKSVYDFHDESDRDEDCFNFTIDENPPPK
KSKKQSSAKFKFPANFDEKAKKGKDPVIDIDGDLPKNGIESLLKASALTTTDNNGRTSPS
TQEAIAGMLSISQTYLQSGKANARSVRKYSTSPPLEDGNLNNVHQDEDYIYPSLDNSDDE
DIHIFKPRGRSKIDEAWNPKARVGPLLPKMNRPAREGTKKQSVEKVLEAAAARRANETPE
KAPKRQYRRKKIKQKLEIKSPASNTVAVGSSSSASTPKPRKGMKTVKQRLGKILKIHKMM
H
Download sequence
Identical sequences D6W7H8
7070.XP_969145 TC010820 XP_969145.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]