SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC010902 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC010902
Domain Number 1 Region: 63-142
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000017
Family Kelch motif 0.02
Further Details:      
 
Domain Number 2 Region: 7-47
Classification Level Classification E-value
Superfamily F-box domain 0.000000000824
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC010902
Sequence length 147
Comment GLEAN_10902
Sequence
MSVVKSPAQIEDLPDEVLEFILSLIPPYKDLHDCMQVSKRWRRCVLNVAKTKLRNLHKAI
VDFDIRWFTLTPVEMAPTISKRYSHTAAIHENSMYVFGGCTCSMTTFNDLWRLDLSKRQW
VRPLAMGTYPSPKACSSLICYKDLLGN
Download sequence
Identical sequences TC010902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]