SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC010914 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC010914
Domain Number 1 Region: 281-543
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-87
Family Protein kinases, catalytic subunit 0.00000000142
Further Details:      
 
Weak hits

Sequence:  TC010914
Domain Number - Region: 70-112
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0876
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC010914
Sequence length 564
Comment GLEAN_10914
Sequence
MSSDEEKPPAPPVRLTSNRGTDILSNSLAMDRPLPKEPDDADRKKKNLKSKKASKLSTYT
SDKPNISYPTNFEHTVHVGFDPVSGEFTGMPEAWSRLLMNSNISKQEQKNNPQAVLDVLT
WFDNTTKEPPNTKYMTKTTTATHSGSSLSRVSSSSPSSTTPTEAEGGSHSYHSPAHAASS
EIEDEAPPPPIASRPERTKSIYTKPIEEVQITNNSVGTPTHSLSPAHTTPTHGANANSTP
PAPILDRNKNQAGPEMSRAASEKRKKKMSDEEILEKLRSIVSVGDPIRKYTKIDKIGQGA
SGTVYTAMETSTGVEVAIKQMNLSQQPKKELIINEILVMRENKHGNVVNYLDSYLVNEEL
WVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALDFLHSNQVIHRDIKSDNILLGLD
GSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMIEG
EPPYLNENPLRALYLIATNGKPDIKDKEKLSPSFQDFLDQCLAVEVDKRASARDLLKHPF
LKLARPLASLTPLILAAKEAAKQH
Download sequence
Identical sequences D6WMU4
TC010914 XP_967769.1.52716 7070.XP_967769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]