SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC012554 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC012554
Domain Number 1 Region: 12-153
Classification Level Classification E-value
Superfamily L domain-like 2.21e-28
Family U2A'-like 0.00000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC012554
Sequence length 237
Comment GLEAN_12554
Sequence
MVKLTAELIQNSMQYINPVKDRELDLRGYRIPEVENLGATGDQFDTIDFSDNDVRKLDGF
PYLKRLKCLLFNNNRIVRIGEHLEEYIPNLETLILTGNHLEELGDIEPLCTLEKLTTVSL
LHNPITSKQHYRLYLIYKLPQLRLLDFRKVTAKEREEARALFKSKKGKEIRKEIGKRAKT
FIPGGTGNSIAKSKGLTDEEIAKIREAINKASSLEEVERLQKILQSGQIPGQEEMNG
Download sequence
Identical sequences 7070.XP_971653 TC012554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]