SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC012937 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC012937
Domain Number 1 Region: 211-244
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000942
Family Rho termination factor, N-terminal domain 0.048
Further Details:      
 
Weak hits

Sequence:  TC012937
Domain Number - Region: 578-610,652-698
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00289
Family Di-heme elbow motif 0.063
Further Details:      
 
Domain Number - Region: 121-162
Classification Level Classification E-value
Superfamily SAP domain 0.0604
Family SAP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC012937
Sequence length 941
Comment GLEAN_12937
Sequence
MELSKDELRKMTLEEIIKLTKGDLKKVGDIIEQISEDNSSSSSTKIQSSDKSSPLTHESS
SMDKYFLTPQSNNEIVLNKLSLKKIKAIAKKMGLKNYSQYNSKTKLDLIKLILKEELNAG
DWFNKLNRLNIKKLKSIAEKLDLKIKQNSKKTDLVNQISDNVNNEANLNTSLTSASHTVL
NEIGSPKLEEILEETMSKNESTQNTSLTSASHTTIKELRKIAKEKNIKGYSKMKKAELLQ
KIEEMEPFAFEDSYFTEFPKKSKIKIIETNAEYTKKWKKHKVYYKVILLKAEEEDSPKSD
LSDIIMKKITVIREGLNEMIKIVKEKTNFKEGDLMNIVVNHPDLWNPISTGLSRTTEIDN
LLNNIQSILTSNQDLDIYGCTFHAEVVNMPRGAGSGVKMLNIAEDSRTKRSITSIKNKDN
LCCPRAVIVGLTYQTNIILGKEFNDNDITYIRKGRNLQTTLAQELCNQLKEYNEEYFTLR
DIANIEKVLNIQIKVIAAECFNQVIYSGEEKDVKVYLYKNGNHFDTINNMTAFYSQSYYC
EKCDKPYQNKDGHKCKKGVKICILCLKPKHKEESKQRIYCEKCNRYCFNQECLSNHSGVC
EEFHKCLKCNKILKRGDKKMVDEGKKMIEEGNEIIEEGDNNKGTHRCGWEKCRNCYKEVE
ILEHKCYMQWKRQKGGICETIMKDGDNKYKVKGCQNCDRKGCTVTYDAFPDETNKQTNKG
KETLLLKDLEKGSGYTITDLQLFTKDGKEKAVVILNNEFKLYLPDRLAKRGDELIGYMLE
YDLVMTYNGLIDVKNNAGFTYKMHDITFKKMDKRPDKTNKYPDETNKHPDETNKHPDKTT
ERIKYHIYQCKDCKNRNKKPLNDTKPFKCVKCRSKYHTTKCSYTEKYLFFDYEAMQETGK
HIANLIISHDFSGNVNSLRVTKILQWLISRDDKDIQLSHIF
Download sequence
Identical sequences D7EKA9
TC012937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]