SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC013115 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC013115
Domain Number 1 Region: 41-287
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.36e-41
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC013115
Sequence length 290
Comment GLEAN_13115
Sequence
MCDKTDNKVAEALEVLKTETSELIHVCPEVPVINVNETLKADWPEAIPNKEVTVAVTPNG
YADGLATKTTEKGKVHYFVMPEEIKMPMREFIKKMDDVSKQYICYIQKQNSNLTEDFSEL
MCDVQSEIPWASKAFDKTPDAVNFWMGDARAITSMHKDPYENIYCVIDGFKDFILIPPTD
LPYVPYKTYPVGTYKDVMNKKCFIEDHKGEKIEWIAIDPLKRNHHDKYPQFKNATQYKVR
IKSGDCLYLPSLWFHHVKQSHKCIAINYWYDMDFDVKYCYFNMLKRLSGS
Download sequence
Identical sequences TC013115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]