SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC013227 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC013227
Domain Number 1 Region: 331-558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-39
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 2 Region: 585-792
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.76e-35
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 3 Region: 835-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000025
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 4 Region: 45-143
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000005
Family Cadherin 0.0097
Further Details:      
 
Domain Number 5 Region: 796-852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000058
Family EGF-type module 0.021
Further Details:      
 
Domain Number 6 Region: 4-59
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000614
Family Cadherin 0.0068
Further Details:      
 
Weak hits

Sequence:  TC013227
Domain Number - Region: 252-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0346
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC013227
Sequence length 1132
Comment GLEAN_13227
Sequence
MAIVSSLRSFDREQQKEYLIPIVIKDHGNPAMSGTSTLTVVIGDVNDNKMQPGSKEIFVY
NYQGQAPETEIGRVYVYDLDDWDLPDKKFYWETVEHRNFKLNEDTGMISMKHGTREGKYH
LRFKVYDRKHTQTDVPANVTVTVKEIPHEAVVNSGSVRIAGITDEDFIRIWDYKTQSLSR
SKADKFKDKIAELLNTDRENVDVFSVQLRRKHPPLTDVRFSAHGSPYYKPVRLNGIVLMH
REIIEKEVGINITMVGIDECLYENQMCEGSCTNTLDISALPYMVNANKTALVGVRVDVLA
ECTCGARNFSKEENCRNTPCYNGGRCIETRYSLSCSCPATYNGPRCQQTSRSFKGKGWAW
YPPLEMCDKSHLHFEFATRKADGLILYNGPIVKPETDEVMVSDYIAVELERGYPRLLLDF
GSGTLELRVKTKKSLDDGEWHRIDIFWDTENVRMVVDYCKSAEIAELEDGTPPEFDDSSC
QAQGTIPPFNEYLNVNAPLQLGGFYVEEFDPTEYHWQYMPVGKPFDGCIRNLFHNSKLYD
LAHPGLSRNSVAGCPQTEEVCGRSDATHRCWEHGTCVGSFNEAKCQCKPGWTGPACLHPT
IPTSFKPQSYVKYALSFEPDRFSTQIQLRFRTREEHGELFRVSDQHNREYGILEIKDSRL
YFRYNLNSLRTEEKDIWLSSVTVDDGQWHVARVSRYGSAATLELDGGEGRRYNETFDFVG
HQWLLVDKQEGVYAGGKAEYTGVRTFEVYADYQKGCLDDIRLEGKHLPLPPAMNGTQWGQ
ATMARNLERNCPSNKPCANVICPEPFECVDLWNDYECTCGEGRVMSADSKDCMDKDECVD
LPCLNGGTCVNLEPRFRYRCHCPDGFWGENCELIQEGQTLKLSMGALAAILVCLLMILNV
RKVTSFTRTVALTRTNVCGCRALTAAFVKITSRRNGYTGGHCELELAPSGAIMPSKDFIV
AVIVCLLALLVLVLVFVVYNRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITP
LQIPIGGPLPELAPPKIGFSVIGVGQEPNVGVFIEEHKKRADSDPNAPPFDDLRNYAYEG
GGSTAGSLSSLASGTDDEVQEYDYLGAWGPRFDKLADMYGPGEETEQEEEEE
Download sequence
Identical sequences TC013227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]