SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC013527 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC013527
Domain Number 1 Region: 266-412
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000419
Family Toll/Interleukin receptor TIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 105-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000228
Family I set domains 0.048
Further Details:      
 
Domain Number 3 Region: 41-101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000485
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC013527
Sequence length 919
Comment GLEAN_13527
Sequence
MKPSVPTALDHGSNFRLLPFTDCDWLTSTKQPRYRKTLGTYKDGKPYPWPLMVSQLILYP
ESANQTVYTQSVTEADAGNYTCLLRNDSVVHSHTIQLKVFEKIPDDPKITYVSKDHQVPL
GQQLRLFCEAFAGRVDLPDAHNEVVWRKSGHNGTLDDEPRVRQEKISREDGQTFGTYLII
DSVRREDFGEYVCKISKPGKSIEQRVFVDEKIEVEYLNPNPVPVAKLLLCLSAIIFLCLA
VVILNLQYGLPLRVRFKDTFGVVEESDGKTNDVLLLYSSKDSELALGTLLPILESRYNYK
CVHRELPSSINYWFGELQNDALKSRRIVTLLSPPVVSDNWTSAAIYQAIKQLQALGSKLT
IITLKELPRCENETKNSHGETLTILLRTINVVHWERTKEEKFWLNLRLRLPPKRRNERLV
DGRSQTQGINSSRLSNDSEESSDLVGEVHQKLVTCVRHLTTTEVSTALRPFYFNVHPDLF
GQYPSQRAINENSLKQLSSIIETLQAKRWTKPASLQFYLRDKKCEEGTFRLIKIYLSERD
IREAVLTILRACDLPTEYVDKIPKPPPEPKKETVRINTSNIDFSKVNENDPIFGPIVMRQ
KINEAKEALKLRNWLVKNYQSALEKLEANRPLREEVDRLRKKIAQQWKLTDVRWDCGWNV
THFRGCLQSFMSLAEQHPEVMHVLKGRTLVFAPFTGISLEGHIMLNSGEVRHNWLDLIKN
VRKHDKILFRIPGFEKSVSQVLRGIKVGRRKFMPKVLAGEYERNLQQITTSLSDYRGRRG
FPKQWPQSLEEFEIVVETEAGPLMVSPTGQFIVPSSLPGFLLVNFITTNLEHAKEKMTEY
KNDKYIERSLQKQCMDEFKLFNLRKDDNITPDLMIKCCERLLEKKIDIEQYLNGIHLNVA
TYYSVLSDGVVCIPWNWKL
Download sequence
Identical sequences TC013527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]