SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC013537 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC013537
Domain Number - Region: 131-159
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00116
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 
Domain Number - Region: 28-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00512
Family Merozoite surface protein 1 (MSP-1) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC013537
Sequence length 174
Comment GLEAN_13537
Sequence
MTNRKGSKRRVVEKTDVSEPRVVVIKDGPCRIGVCGEEAACKDYRNNTHTCICTHDSRPP
TAKGICPRRTVSVDRSGIIPYVQPPSYKQTPSSLSSTTIPIVSPINLKHSLLMAERYAPN
PQYSACSGTGVPLLRKETLKFISEIGEGCFGKVYKGKNIECGYCKNAKNIHPQE
Download sequence
Identical sequences TC013537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]