SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC014173 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC014173
Domain Number 1 Region: 34-330
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.28e-61
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC014173
Sequence length 451
Comment GLEAN_14173
Sequence
MDDVNFAHRARKRIKEVKKKARPELSTKESWIQCNYANNFKKFWDFTDNCERIDESKVSQ
REFISNYELPYKPVVITGTQVGWKANEKWTLEKLVKKYRNQKFKCGEDNDGYNVKLKMKY
YVHYMLNSKDDSPLYIFDSNFGEHRRRKKLLEDYEVPYYFRDDLFKYAGENQRPPYRWFV
MGPARSGTGIHIDPLGTSAWNALIQGHKRWCLFPTHTPKELLKVTSSVGGKQLDEAITWF
NFIYPKTKEPSWPADCQPIEILQKPGETVFVPGGWWHVVLNLDTTIAVTQNFCSRTNFPV
VWHKTARGRPKFSRKWLKALVKHEPDLAKLAERINIEQPSGMASDSSSDSSSSSSSDSDS
TDSEDGDSGQESITAKKKRRKSDNESERNRKISRTNIPEVVELASLTFHAHEEDYDHVDG
NGKKRARERRHEINSCGTYKKYGDAKLIVHD
Download sequence
Identical sequences TC014173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]