SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC016029 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC016029
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily L domain-like 0.0000000191
Family Ngr ectodomain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC016029
Sequence length 135
Comment GLEAN_16029
Sequence
MLNHNEIVELHDGILDDLQVEKLFLYLAYNFIETLPTNIFDNRSLDTVDLSNNKITVIAD
ICKRCIICHLLVYDNPLNVTHYDKILEFGKLNDIDITGLDFGKNNSHGFYTRKFVIVLIL
CLLLSPSSSQIISNF
Download sequence
Identical sequences D7GY62
TC016029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]