SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC016216 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC016216
Domain Number 1 Region: 124-212
Classification Level Classification E-value
Superfamily F-box domain 3.27e-17
Family F-box domain 0.004
Further Details:      
 
Weak hits

Sequence:  TC016216
Domain Number - Region: 36-74
Classification Level Classification E-value
Superfamily MIT domain 0.00863
Family MIT domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC016216
Sequence length 388
Comment GLEAN_16216
Sequence
MARGVEDVLSTFREKWQKELQISPPKREHQSQDTPQDPDAETQARRLFLKGVDLEKSGKL
YESIQFYRRAVQLVPDIEFRIDKEEMHEKDEENSEGEHEVTREGELLQRIQKKLSKRPAL
CVPKTEQKGTHISVLPTEMILHILRWVVSAELDLRSLEMFSMVCRGFYLCARDPEVWRLA
CLRVWGLNCGNSPYNYLSWRHMFIERTRLHFNGCYIGKTTYIRHGENNFQDQFYRPWHLV
AYYRYLRFFPEGVVLVLTSSEEPAQCVSLMKSRNARSPILRGYYRLKDDKVTLVVQRQDN
KHVPGFKKKRRGGDLREMAEQTFHMELQIKSTNKKRHVQLVWTHYSVFTRTHKGDESTCN
FDLVGNRFPPFWFSRVKSYTSESDSPLQ
Download sequence
Identical sequences TC016216 7070.XP_966835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]