SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC016323 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC016323
Domain Number 1 Region: 39-201,243-350,401-482,511-597
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.24e-57
Family Glutamate-cysteine ligase family 2 (GCS2) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC016323
Sequence length 639
Comment GLEAN_16323
Sequence
MGLLTEGTPLTWEETKKLAEHVRQHGIIQFINLYKRLKDRQGDVLKWGDEVEYILVKFND
EKKVARVSLRADEILTELNKKELENPETVKSLWRPEYGAYMIEGTPGKPYGGLLAHFNIV
EANMRHRREEASQLLKADECLMTITSFPRLGCPNFTDPATKPTPEEGATRSLFFPDDAVF
SGHPRFKTLSRNIRQRRGEKVAINLPIYRDKNTQIPVDDSYKYSSAALPDHVYMDAMGFG
MGCCCLQLTFQACNITEARTLYDQLTPLCPIMLALTAASPLHRGFVTDVDCRWNVISCSV
DCRTKEERGLAPLKNDKFVIKKSRYDSIDSYLSPQGEKFNDVPLIYDPKIYQQLVDNDID
HLLAQHIAHLFIRDSVSLFSEKINQNDEEDTDHFENIQSTNWQTMRFKPPPPNSTIGWRV
EFRPCEVQITDFENAAIVCFVVLLTRVILSYNLDFLIPISRVDENMQNAQKRNACMEQKF
WFRKEVTTQISPPEANECCKKGTTNCEPKNCDVYTCMTVNEIINGKDGEFPGLIPLINTY
LSGMDVDADTHCTIQQYLKFIQRRASGEILTTASWLRKFVTEHPSYNKDSKVTEEINYDL
LQTIKGIQSGELSCPELLGYSTMSKTKENIPSALSLSNC
Download sequence
Identical sequences D6WMT3
7070.XP_966349 TC016323 XP_966349.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]