SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC030584 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC030584
Domain Number 1 Region: 153-428
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.49e-48
Family Guanido kinase catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 46-130
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 0.00000000000000183
Family Guanido kinase N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC030584
Sequence length 444
Comment GLEAN_12847-OG11454
Sequence
VDDTCSARKDLDDEDMLNVLERCYNVLHGRRNSNTVSAASNASSATNVSYTSSIIAKHTK
RYVFDAVKNRMTKLDHNLYDVIWPSVKKLPSELSFRVALEQDFPAGIVAPDVYVYKVFKE
YLEPIIKEYNAIDVRHELGVHPATKFVQEENGNLVDVEFDLDPQARWIISGTLDCTRNLL
DFELPKSLNVNQLETVERLVTSVLLSPELGHALYPNASEDDLSDGCGVYYTMNEVLEDPS
EARVILASNGLLIPLWNIPESDRLHGKHWPYGRGVFITNGSNLAVWINVLDHIRIVTCSP
HTKPGNIGLIYSRIARLDSILQKHLEFKRDEKLGYLSARPTCVGNTLQFNFTLRFPNLSK
QPDNLRHLCFVRGLTFNRKTNTSDIVRIGNQQSLGVCEYQSFEDFTTAFLNILQLEKDLA
VSNSLHIAAAFVNMFKRKKMSLAE
Download sequence
Identical sequences TC030584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]