SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC030704-GA from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC030704-GA
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000225
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC030704-GA
Sequence length 75
Comment GLEAN_04645-OG27542
Sequence
MPIDTPAGKPTITTAHNTSSTALHISWRPPHHETIHGEFLGYRIAYRPRDRGDEAFKEIY
IRDPNVEFHNSFVSM
Download sequence
Identical sequences TC030704-GA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]