SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC030735 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC030735
Domain Number 1 Region: 3702-3907
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.21e-32
Family Laminin G-like module 0.00082
Further Details:      
 
Domain Number 2 Region: 3418-3613
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-31
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 2134-2153,3202-3362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-30
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 2538-2629
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 2449-2528
Classification Level Classification E-value
Superfamily Immunoglobulin 4.57e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 2263-2350
Classification Level Classification E-value
Superfamily Immunoglobulin 8.38e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 7 Region: 2177-2257
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000119
Family I set domains 0.05
Further Details:      
 
Domain Number 8 Region: 1041-1122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000121
Family I set domains 0.017
Further Details:      
 
Domain Number 9 Region: 2945-3031
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000212
Family V set domains (antibody variable domain-like) 0.09
Further Details:      
 
Domain Number 10 Region: 2866-2940
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000152
Family I set domains 0.017
Further Details:      
 
Domain Number 11 Region: 824-911
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000755
Family I set domains 0.026
Further Details:      
 
Domain Number 12 Region: 2615-2721
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000194
Family I set domains 0.018
Further Details:      
 
Domain Number 13 Region: 3036-3116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000401
Family I set domains 0.06
Further Details:      
 
Domain Number 14 Region: 2357-2441
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000631
Family I set domains 0.016
Further Details:      
 
Domain Number 15 Region: 198-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 16 Region: 417-456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 17 Region: 610-649
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 18 Region: 688-726
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 19 Region: 1002-1041
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 960-996
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 21 Region: 496-533
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 22 Region: 571-608
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 2768-2849
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000352
Family I set domains 0.026
Further Details:      
 
Domain Number 24 Region: 917-955
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 25 Region: 371-410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 26 Region: 3128-3198
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000671
Family I set domains 0.021
Further Details:      
 
Domain Number 27 Region: 760-799
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 650-687
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 6-46
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000103
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 30 Region: 1770-1814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 31 Region: 533-571
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 32 Region: 3644-3686
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.011
Further Details:      
 
Domain Number 33 Region: 3355-3397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000186
Family EGF-type module 0.012
Further Details:      
 
Domain Number 34 Region: 46-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 35 Region: 1433-1481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 36 Region: 323-349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000034
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number 37 Region: 460-494
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000825
Family LDL receptor-like module 0.00095
Further Details:      
 
Weak hits

Sequence:  TC030735
Domain Number - Region: 1734-1772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000468
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 2077-2118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00201
Family Laminin-type module 0.072
Further Details:      
 
Domain Number - Region: 1822-1868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 1369-1398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.018
Family EGF-type module 0.082
Further Details:      
 
Domain Number - Region: 1479-1527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family Laminin-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC030735
Sequence length 3942
Comment GLEAN_14126-OG487
Sequence
MKLTSTNVMCDVNEIPCHSGECVPSEARCNGNFECADHSDEAGCDCAKGEISCDITRCIP
ESKRCDGMKDCQDDTDERDCIERPSADTMSSSAMVPANASRCNNAAMATGIVPITKTKPT
APNKLVTVNILHVHTTQCDAVLTNSLVKMELVSRYQQNAIQSTIAKICPTNEIVVSVTRN
HLIVFLVLTSNNHPLVSLSPTSCKPTDFQCNNGVCILPHLRCNGVHNCQDKSDEIGCPSS
PIKISTPFLAFGTRLDTQKSTNQKPSCVFVCLKSAWKCQKGVGFLATVFHLDLNVKRVLA
LVCRNAATGNSIVVKGRMSYLALCIKHSRYCDGIQDCEDYSDERFCSTPSKIVIKGKKSL
TRISFNLCYPLSKCPEGTFECAAGFCIMGYKRCNGIKDCPSGNDEDGCPTTITPVTPEPS
CASSEFRCNDGRCIDISYRCDDIPDCRDKSDEINCYSAGACATDEVLCNDGSCVSGKKCD
RSFDCPDGSDESGCSFCTPDQFPCQGGGCIAEHLRCDGTIHCSDGSDERNCGCLPSQFDC
GDSSCINSEFRCDGYQDCKNGRDEMECSSTYCHEEDEFRCSDGTCIPNSAFCDGVRHCRD
GSDELDCPPPPSICTVNEFQCDNGECIPNYLRCDGVSECPDRSDERECRTCHEPDWFQCS
DGLCVDATLRCDNFYDCRDFSDEQNCFECRTDQFQCSNGTCIAGNLRCNRRNDCSDGSDE
FNCPTQPPPFVTEQPLPPRPPQITCSPGTQPCHKPKREGACSRGQFRCENGPCIREELRC
DGKVDCPRDSSDELDCPTRYRNRLMDNLTTNNRSGPSEGLNLRTYPSSQEIKENREVVFQ
CRDEGPFRARVRWTRPNGEPLPPGSRDHNGRLEIPNIKVEHSGTYTCEAVGYPPNTPGAH
VSVHLQVDRWIPPPIRPPTACALHEATCSNGDCIPKHQVCDEKYDCTDGSDENRCNPNGC
EPNEFRCANKKCVLKTWRCDSDDDCGDGSDEENCATNPPGSLCAYHQFACHSNNQCIPRS
YHCDLERDCIDGSDEIGCSIPVVSKPPPPMVNLEVGSTFEITCTAVGVPTPEIVWRLNWG
HIPPKCRTTSDNGFGTLSCPNIQVEDQGAYSCEVINIKGTVFAIPDTILVINQNTVCPAG
YFNEEARSQAECIKCFCFGQSTKCRSADLFIYHFQPPFDTLKLLGVRIDSNTGVIDIRDE
PIYRNAQPQLTGLGRNGVHAQLPPYGQISSSDLVPYFAMPENYHGNQLKSYGGYLRFTVR
HYNRGYTIAGPTVILTGNGYTLLSRHNISPPSNRDEQIEVRFFEGEWVKRSDRQLETPAT
REEIMMALAEVDNILIKLQYNEGPLNTTITNIEMDSAGAPNSGLGPASYVEECECPVGYS
GSSCERCADGFVRHKTGPWLGQCYRVQPQPCPPGTYGDPSRGRPCEICPCPLTSPSNQTC
SLGSDGEVTCDCPPGYVGRRCEQCAPGYSGNPLIPGDSCRASSYCNSEGTSLEEQGRCRC
KDYVDGPTCDTCKANTFHLSGENQFGCIACFCMGVTRQCSSSTWFRDQISTTFTSSRDHF
TLIDTERREEPITDAIRLDQNQREISYSSFSNPNVHYWSLPRRYLGNKIASYGGYLKYTL
RYVPLPGGQISRNSAADVELVSANEITLLYYAREQSQPTGSPQTFVVPLLEQYWQRSDGQ
KADREHLLMALADLNAIYIKATYNTNTRESALISVSLDTANEYNTGSSERALAVEQCRCP
EGYTGLSCEDCAVGYTRAEEGIYLGICEPCNCNGNSRECHPETGVCQNCDNFTTGDNCEL
CLPGYEGDPANGIPCVGGSSQCNCDQQGAISPECYNGICRCKTNVEGNRCNRCRPGTFGL
SGGNIHGCQTCFCSGVATECVEGNLFYEQIPIFIDADRHGFTLTDQYQTQRIDSGFQIHT
SMNEIGYTFRPSTSERWFWSLPREFTGNQVKSYGGRLEFTQRFTQRPQAGYVPDKSVIII
GNGITIYWTNPQSQIPDVPNKVSVVLNPSSNWQRLDGNQGPRPATREDIMTVLANIDVIL
INAQPSSDTESAYISDVTLDTAIEQNTFNPQSRAIEVEICRCPTGYQGTSCESCAPGFYR
DTNDFSTGPLGSCSRCPCNNHEQSCYLAPNNRVVCNCLPGYMGERCVTGDGNVTTTPGPV
YSTPHPLTMEITIVAPVIEIYKVGSTVRFNCSARSLLGPRPIRVTWTKDGAGLPAHAIDD
GRGILVITNLKVSDSGRYICEATDGYAIESKDITVTVGPSQLEPPRVVITPPFVDVQEGQ
TVQIQCAATGTPEPILRLIRLDGQQLNPAHYFQNGLFRIPQAHKSDEGPYQCIATNAAGT
HTSNVDIYVRENTGGRPVTVEISPPYYEGSSGETFSLRCQADRAIDIKWTRQNGRPLPYS
FIVNRDVLTATSPRAEDSGVYVCTATSATGYTATGTADVTIYESSGAKVSPERITISQGS
STELRCDATGSPTPTIKWTRVGSELPPHITQSGSVLYIRNAQVSDRGVYVCVSSNNLGLA
QASSIVEVNRLEIPILSVHPQASQTVTAGNSAILACRVDAGIPAPTVVWTRADGRPLSPN
IETMSHGTLRFTQITENEGGEYICTAENEAGRASVTANIEVQVAPEVWTVPDEDVIMRRR
DEFVRLECHARGSPPPSLQWRRLSEPYGASGRSGLPAVAAPRNVAILEIARFSARDQDLY
ICEARNQAGVAEKRVQLAIHSVPSRGDIVGEDATGNEVTPPEGGYRTNERRPTYLPPRQR
PSHSYDEKFTAPVGTRAELRCQINNNYDSEPIYVNWARTDNSSLPNDAFIRSGTLYIDNV
QPSAGGEYRCLGTTSSGQVVFSVIAHLEVISHVPCANSNNTDPHSFVRPGDNAYIQCSAT
GQQPITIRWVPVGRSFPPTVNTQDGLIQFNNIKLSDAGRYRCTAVNSAGEADAVADVIVE
ENVHKPSLTAENRQQTGPVGSTITLRCRAHDSSIVPNIRWFRERLPLPQNSQVQGEVLTI
YSLQPQDEGRYYCEMATDGGSSSDYVDLHVTNLHITPAERTYRAGEHVDLNCQSSEPGVI
TTWSKLAGWFESNVQSAGGTLRIPSVRPENSGTYRCEATGYQGVYHKDYQLEVIDRDLNL
DEPPLEIKTAPQGSTVIMECKTDLEPPVSYMWTKQGRSLPNNVDVHSVINSMDAGVYTCT
QNNGDRKIDTTTVLTVTGIVPHFAQAPTSYIALENTVDLYIQFNFEISFKPQNSDGLLLY
NGDKGSDRNGDFISLALVNGVPEFRFNLGGGVATVTADRPVTLNEWHTIKIIRYRKKGKY
IGLDLSEQLYLGGVPDFDEISPEVGVSNGFVGCISRFKIGYNHIDITKQAKSKHGITTCE
TCSHDRCKNRGVCQEALSPEGYSCICTPGYSGPNCEKLKGEACSPYTCGTGRCLDNDSGF
DCLCPMGRAGRRCEREISVNEPAFSNGAYIAYPVPKLQRRFKAALKIKPTDNRDGILLYC
AETDEGHGDFVSLAIKDRHIEFNFNVGGRPVTIRSEKEVRPGEWHVLTATRSLSEGRLIV
DGETTFGTTPGNHKTLNLLTRLYVGGYDSENIKINDKVGVHSGFNGCISEMSGLDLDVIN
SAEDSANVMECSSLDNEVDNNVGGFEYVHENTPTTSQPYNSRRTGCSSNPCKNGGQCYPL
SPMDYNCNCLSGFSGKDCEIEMNICEQKIPCQNGGTCSGNATGYECSCPLLFSGKNCELR
VELRNDAHFNGKGYLEFDRDLLDHIKENEDELIAVELSTNSSDGLVFWHGQTPNEDGQGK
NYISLGVVNGYLEFSYDLGSGPAIIRNTQKRVDDGQRHSAILKRRGRVGSIEIDNAYTQT
GESPGFTNTLSCAGNIYLGGAPNIGLMTGRRFSHGFDGCVHAFELQNLKTLDLGIRAISG
VNVKPCSRIRWIPSSLIFADSDQFDEIVEPPPVNIIHPKPSM
Download sequence
Identical sequences TC030735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]