SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC030768 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC030768
Domain Number 1 Region: 16-281
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.9e-90
Family GatB/GatE catalytic domain-like 0.0000011
Further Details:      
 
Domain Number 2 Region: 301-399
Classification Level Classification E-value
Superfamily GatB/YqeY motif 0.0000000000000014
Family GatB/GatE C-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC030768
Sequence length 469
Comment GLEAN_02824-OG7840
Sequence
MDVFKIGKIANNQWNSVVGLEVHAQINTTSKLFSGASTKFSAPVNANVALFDCAIPGTLP
VLNKKCVEFGVLTALALNCRINPAGYQITQQRHPLANDGRLEFQVFSPGVHKAPYKRQVR
IKQLQLEQDSGKSLHDTDRSLVDLNRAGVPLMEVVFEPDLSDGEEAAALVKELIAILQRL
GTCSCKMEEGALRVDANVSINRQGEALGVRTEIKNIGSVRGVAGAIRYEIERQIQVKESG
GAVENETRAWDALGKVTVSMRDKEQDYRYMPEPNLPPLHVAMGPVSQGCVSVDSLKSSLP
ELPEGTRVRLRESSGLTLEQSIILVNDSSLLNLFEDVWRAKKIEGKLLANLLINEYTSIL
NKMDLEPSQFSFNSDYFGEIAVLLQNGEITRNTVKLIVREKNWLQITDEDALRQLCQEAL
DQNEKVVKQYKGGKTKVFKALLGYVATKSKQRADMKKCDKILKELLNKQ
Download sequence
Identical sequences TC030768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]