SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC000086 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC000086
Domain Number 1 Region: 1259-1379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.22e-17
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 2 Region: 590-710
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000455
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 12-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000204
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 416-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000345
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 5 Region: 1425-1501
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000723
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 709-824
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 7 Region: 131-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000179
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1372-1420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000343
Family EGF-type module 0.016
Further Details:      
 
Domain Number 9 Region: 1146-1257
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000157
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 553-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 11 Region: 826-942
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000424
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 1100-1147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000481
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 1491-1547
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000167
Family Complement control module/SCR domain 0.0046
Further Details:      
 
Domain Number 14 Region: 1065-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.016
Further Details:      
 
Domain Number 15 Region: 939-1062
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000973
Family Growth factor receptor domain 0.0096
Further Details:      
 
Weak hits

Sequence:  TC000086
Domain Number - Region: 516-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00698
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 174-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0495
Family EGF-type module 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC000086
Sequence length 1829
Comment GLEAN_00086
Sequence
MITESSLQTLTKCPPNIKTKCPQDCIIKNNKPTCRCFPGYTFKHKKCIDINECKNGKHKC
EKKCINLPGSYKCACPQGFRLLPDGKTCEDINECLLRNGHGPCQDLCENTHGSYKCICRN
GTKLAPNGHSCTDLDECSEKNSGCSHGCINTHGRVYCTCPIGLELGPDWKTCKDVNECDD
EKIKGSCPYGCVNTVGSYFCAKAMADQPVDEDEDYEGEEDDYETEEYDDKDYEEEQERNK
TDKEYNGIDNVPELNFDKVDEALEINKNENVISNNKSEVIDKGVHGKEEITNNNTDEYED
EDDYDDEEEEEEDYEDETDSTEKPFTIVDSLPTTTRTTEEIATTLAPIAQSEDDEESFTE
ETVNKPEESDLPESRTETENLTTTEDNERAVDEDDEDYDEDEDEDYDDEDDDFGDHDRCI
EGYEMNDKGDCVDIDECLSSSPPCSHDCENLEGGYKCLCPPGYELDIPDFNTCQDLNECI
SNPCAYKCVNEIGTFHCECPEGYLLLANNSCTKITCPQDHVVEHGVQRCICPRGYTQSRN
KITCDDVNECDGDHGCTHLCINHEGSYSCSCYDGFALERDNRTCSDVDECRKGVCGQKCE
NTEGSFRCFCDKGYELANDGKTCLDIDECEREDSCEQLCHNFDGGYECGCEKGFKLDEDE
SSCYDINECESNNGNCSQICENFDGGFVCKCHNYYKLSHDNYTCVPLDPCQENNGGCSHI
CTNDNNEAVCKCPEGYELEDKSCVKINPCTINNGGCSHFCQHINDQINCHCPERYDLVND
TLCVEQNPCLDHNGGCSHICTTVNNQVKCECPEGYELDDKTCLKINPCTIHNGGCSHLCT
IVNNQVACECPEGYELEAKTCLKINPCTINNGGCSHFCEFVDDQINCLCPEGHDLVNDTL
CVERNPCLEDNGGCSHFCAFFNHTIICSCPHTHELHNETSCYLKNPCLDQNGGCSHFCHF
ENDQLSCSCPDNFYLEGRICYRKDPCLVKNGGCSHQCFSNDLGEVECSCPEGYDLRDKTC
IIPDPCDNNNGNCSHECVSDGIKATCHCPEDYVRINETHCVPDLCLVENGGCSHKCDFDG
DQVTCGCPHAYDLGPEGRICAPRDPCTVQNGGCSHLCQNFGGTVKCDCPEFYNLSDDGHT
CVRVSLCSIDNGGCSHECTEEGNYVYCLCPEGYSLEDKTCIPIDPCRKNNGGCSHECTSE
ANIVYCLCPEGYELDGKDCILNPCHDNPCSHFCEVVDGLAVCKCPQNYELVGKTCTRINP
CQINNGNCSHTCVSNDGIATCTCPPGLKLQDKTHCVVENPCLIDNGGCSHQCHNQDGTAR
CTCPPGYILRPNNRVCKEVNECKIRRGGCSHGCRNLPGSFQCTCPPGFELGFDNRTCVDV
NECLEDNGGCHMTCINYKGGHKCGCEQGYALQEDGRHCEAITFRDCRVPVAPDQGIIKCI
GGNYEKGSLAPVGTKCMVWCNEGHKLVGESVRVCQSTGSWGGKEPQCVAAACPRPGPIQN
GWLLPSNCNNGFTYGGEKCRIYCKRGYKLRPRFEFLSCSEDLIWQPLEAVNRLHDVCVRD
IEHTYIKCPGGGHLTYTLPQGQRHMYAKIPQPETNANWIRDVKAEPSWGMQLGTILPAGH
TQLTFYVDPEDPSLLLHSNLTSCKLVITILDIEDPKVTGCPTNMEYTLPRGHSSQLVFWK
EPQFSDNVGIARLYKSREPGTSFGVGLHHVNYVASDEAGNRAFCHFTVDIKEEIDSPSND
LASNLEKRSEKYRAVLVCPSGVQYISKPPDLYNNKIATEAGCYWRHVRVSRPLQPQGLRI
PPHRIHNESRLPPHLQKKHRYFEWYDKCC
Download sequence
Identical sequences TC000086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]