SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC001808 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC001808
Domain Number 1 Region: 441-809
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.67e-105
Family Reverse transcriptase 0.0003
Further Details:      
 
Domain Number 2 Region: 973-1125
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.22e-39
Family Retroviral integrase, catalytic domain 0.007
Further Details:      
 
Domain Number 3 Region: 322-418
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000101
Family Retroviral protease (retropepsin) 0.024
Further Details:      
 
Domain Number 4 Region: 251-289
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000107
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC001808
Sequence length 1278
Comment GLEAN_01808
Sequence
MAELQPVLTAMTEILNRIHDTQRQLLNQTQNTASVKENLHPYDENYETFDCYLQRLDNHL
KLKKMDDSTDERDKMCVQILISCLSPKIYQTLTKLTAPDLPNTKTYRELIKALKEHLAPQ
ASVISEQHKFSLRVQHEGETIANYVAELRKMTINCEFKCSHCNTSTINTHLRTQFIRGIR
DTEIRERLLQQKSTVTFEDIVQIAQSVETAKKESMQMQRSELEVNAVRKDKSLRTNEQRK
KKPEKLQEMWGKCFRCGKTNHKADSCSAKKLTCKHCGKLGHLQAVCFKAKSQNQKQVTKI
EEEEGEFTNLYNIVTINSVSAEKILLPIKLNNSKCKMELDTGAAVSTISEKKFKSLCPGA
KIKSTEVKLRTYSGEILKPIGSCNVNIEYQGQRARGDIYILSQDVDTIFGRDWLKNIKLD
WNTIHQIDTLNYKDELNRTLEEFKDVVSTKLGRIPNYEYSFKLVEPNTQPIFLKPRAVPY
ALRGKVESELDRLEQLQIIEKVTHSTWGTPIVPVVKKDGTIRLCADYKTTLNRVIEEDRY
PIPKIEDIFNKMRGGKYFCTLDIQKAYLHMPVDEESAIMQAISTHKGVYKVKRLMFGVKT
APNAWQRFMDQMLQDLEGVVCFFDDIAVQGKTPDELLVRLRCVLQRLRDFDLHVNKDKCQ
FFKTNISFLGHKIDKNGLHTTKEKVEAVVNSKRPEKLSELRTFLGLVNYYQKFLPNLSSK
LHPLYQLLKKNVPFTWTTDASPTGLGAVLSHRTSDGAERPIAFASRSLNKSEKNYSQIDR
EALAIYWGIRKFFHYCYGRKFTLKFDYDIKFRKTEEHSNVDYFSRSSLPSTTDKRDDAAI
FQISQLEFLPITRKQIKKESLKCPEIRNIILALQTGKPLPKNYPQSEFSIQDGCLFKGIR
VAIPKSLRKYILEEIHTAHIGIVKMKALARSHVWWPLIDLDIERIAKECLSCSRFRNNPP
KTNYHPWDYAIVPWQRIHIDYAGPFLNTYFFIIVDSYTKWIEVFPTSNMTANTTINILRE
TFARFGLPYTVVSDNGSNFISKEFEDFLKMNGIKHKLIAPYHPATNGQAERYVQTVKKSL
RSMQWERGNLHLKLSRFLMQNRKTPNITTGVSPAELIFKRNIRTRIDLVKLELSPEMQEA
KLPGDKKDRSFEENDTVLCRHYGDKNQKWKYGTIVTRNGNLNYEVCVDGRIQRRHVDQLL
PYNGPIPFQGIPVDSEIDNKEPNQELPTVETEELPRPISESTPVLVPEPEQPVIVNESGT
LTLRRSTRIRKPVDRLNL
Download sequence
Identical sequences TC001808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]