SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC001809 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC001809
Domain Number 1 Region: 440-877
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.67e-123
Family Reverse transcriptase 0.00012
Further Details:      
 
Domain Number 2 Region: 1035-1187
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.02e-37
Family Retroviral integrase, catalytic domain 0.007
Further Details:      
 
Domain Number 3 Region: 320-418
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000938
Family Retroviral protease (retropepsin) 0.021
Further Details:      
 
Domain Number 4 Region: 251-289
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000112
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC001809
Sequence length 1330
Comment GLEAN_01809
Sequence
MAELQPVLTAMTEILNRIHDTQRQLLNQTQNTASVKENLHPYDENYETFDCYLQRLDNHL
KLKKMDDSTDERDKMCVQILISCLSPKIYQTLTKLTAPDLPNTKTYRELIKALKEHLAPQ
ASVISEQHKFSLRVQHEGETIANYVAELRKMTINCEFKCSHCNTSTINTHLRTQFIRGIR
DTEIRERLLQETSTVTFEDIVQIAQSVETAKKESMQMQRSELEVNAVRKDKSLRTNEQRK
KKPEKLQEMWGKCFRCGKTNHKADSCSAKKLTCKHCGKLGHLQAVCFKAKSQNQKQVTKI
EEEEGEFTNLYNIVTINSVSAQKILLPIKLNNSKCKMELDTGAAVSTISEKKFKSLCPGA
KIKSTEVKLRTYSGEILKPIGSCNVNIEYQGQQARGDIYILSQDVDTIFGRDWLKNIKLD
WNTIHQIDTLNYKDELNRTLEEFKDVVSTKLGRIPNYEYSFKLVEANTQPIFLKPRAVPY
ALRGKVESELDRLEQLQIIEKVTHSTWGTPIVPVVKKDGTIRLCADYKTTLNRVIEEDRY
PIPKIEDIFNKMRGGKYFCTLDIQKAYLHMPVDEESAIMQAISTHKGVYKVKRLMFGVKT
APNAWQRFMDQMLQDLEGVVCFFDDIAVQGKTPDELLVRLRCVLQRLRDFDLHVNKDKCQ
FFKTNISFLGHKIDKNGLHTTKEKVEAVVNSKRPEKLSELRTFLGLVNYYQKFLPNLSSK
LHPLYQLLKKNVPFTWSKECERAFQEIKNDITSTKILIPFNEDLPLILATDASPTGLGAV
LSHRTSDGAERPIAFALRSLNKSEKNYSQIDREALAIYWGIRKFFHYCYGRKFTLVTDNK
PLTSILHPHKDLPSTSATRLIHYATYLSGFDYDIKFRKTEEHSNVDYFSRSSLPSTTDKR
DDAAIFQISQLEFLPITRKQIKKESLKCPEIRNIILALQTGKPLPKNYPQSEFSIQDGCL
FKGIRVAIPKSLRKYILEEIHAAHIGIVKMKALARSHPLIDLDIERIAKECLSCSRFRNN
PPKTNYHPWDYAIVPWQRIHIDYAGPFLNTYFFIIVDSYTKWIEVFPTSNMTANTTINIL
RETFARFGLPYTVVSDNGSNFISKECEDFLKMNGIKHKLIAPYHPATNGQAERYVQTVKK
SLRSMQWERGNLHLKLSRFLMQNRKTPNITTGVSPAELIFKRNIRTRIDLVKLELSPEMQ
EAKLPGDKKDRSFEENDTVLCRHYGDKNQKWKYGTIVTRNGNLNYEVCVDGRIQRRHVDQ
LLPYNGPIPFQGIPVDSEIDNKEPNQELPTVETEELPRPISESTPVLVPEPEQPVIVKNQ
WSDMLLRYVF
Download sequence
Identical sequences TC001809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]