SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC002000 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC002000
Domain Number - Region: 246-346
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000127
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC002000
Sequence length 348
Comment GLEAN_02000
Sequence
MSSQAMDNEAKGYKMHHLVRNSNTGLLELHEELTEEILKNGSIIRSSWSRESLVEHKKQL
ELSQEIKPEPPEQKETQIIQTYAQDDLLTEPYIKEEIVVDEESSFDALPDVFPKEENIGQ
DPLEITRYEASTSENFDKNKTLLSLSKFLKTSRKKITMDELEQFCIEKKCKVIVCKNDRK
KLGFVSNHLKMQQQIIKRMDKKKVERLQQGPFRLDVNESMRSLQVSDAPTSQPCNILFPS
PKPIKRLKPPTRPTLSARKVGTDVVLKWRMPHCSSDVYAPVASYEVYCYILTTSNKRHKW
RKLSKMEASPIFTTLTLKDIDAEVINSFVVRAIDIYQRRGLFSKVVSV
Download sequence
Identical sequences XP_015840066.1.52716 TC002000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]