SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC003185 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC003185
Domain Number 1 Region: 150-283
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.1e-19
Family Toll/Interleukin receptor TIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 12-104
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000001
Family DEATH domain, DD 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC003185
Sequence length 400
Comment GLEAN_03185
Sequence
MEAAGESREVPITVLRPKTKALLCDLLNPQMFMPGPNGVLRYWRGLAGLCQISPNYEASL
VNDSNPTDKVLQLWYEKDPQRCTVQQLLLFLEEMDRFDVADDVLDLIDEDIKLYKANPQG
YELKPLYSEADKYIITTDDVIRINEGRDLEIYDAFLLYDHDDIEFAIELLDRMEKEYGMK
FCVKDRDLVGGGLEMDKMIKLITHRCNRLVVILSDSFFKSSANEYYLSFAHAYGIESQRK
IIPCIYKNLTTNPPHMKCLFTLDFQRMAAFNVWDKLRDSIRVVSAEKFKVNRSQSDNGQV
LRSALHQRDPIGLRPLNHGVKFSSSVGDLKSTEAISEPPLNPSTSADNLESCSEQKKEKK
TTLLKKIKGHFKRDKDCSSKAEKGSKGLKKHLKRATAVAN
Download sequence
Identical sequences D6WEI3
TC003185 XP_008190563.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]