SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004130 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004130
Domain Number 1 Region: 181-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-56
Family Voltage-gated potassium channels 0.00072
Further Details:      
 
Domain Number 2 Region: 40-145
Classification Level Classification E-value
Superfamily POZ domain 1.65e-31
Family Tetramerization domain of potassium channels 0.00000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC004130
Sequence length 571
Comment GLEAN_04130
Sequence
MASVAAWLPFARAAAIGWVPIATHPLPPPPIPKDRRKADDEKLLINVSGRRFETWRNTLE
KYPDTLLGSNEREFFYDEECKEYFFDRDPDIFRHILNYYRTGKLHYPKHECLTSYDEELA
FFGILPDVIGDCCYEDYRDRKRENAERLMDDKLSENGDQNLQQLTNIRQKMWRAFENPHT
STAALVFYYVTGFFIAVSVMANVVETVPCGSRPGGAGSLPCGERYKIVFFCLDTACVMIF
TAEYLLRMFAAPNRYKFVRSVMSIIDVVAILPYYIGLGITDNDDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLVFSLAMAIIIFATVMFYAEKNVGKTNFTSIPAA
FWYTIVTMTTLGYGDMVPATIAGKIVGGVCSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRKAQRKARLARIRIAKASSGAAFVSKKKAAEARLAAQESGIELDDNYREEDIFELQHHH
LLRCLEKTTDREFVELEVPYNGHPKRPGSPSPMASPAHSAVSIGLIQSCCGRCCPRRYQQ
ACGKYMPAASAAQSNQTGGGMDGTYLVEASF
Download sequence
Identical sequences D6W6N1
XP_967467.2.52716 7070.XP_967467 TC004130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]