SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004145 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004145
Domain Number 1 Region: 314-373
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000236
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 2 Region: 104-126
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000379
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  TC004145
Domain Number - Region: 398-428
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00235
Family CCCH zinc finger 0.0042
Further Details:      
 
Domain Number - Region: 243-268
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0549
Family CCCH zinc finger 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC004145
Sequence length 500
Comment GLEAN_04145
Sequence
MADSNQGFSDTQKFCFDLVRLGETHGFGSVQPLAVYNQNILFLFLCPLEAQCGHLSVKPR
FWRYYERNVCKKPGCSLTHKRKNHIDVVQVKPRDGCVIGRLKTAPLCRYFLRGYCTHAGN
CRFRHEIIPVNMRNVPNTNSNQPSSTNTPSTSATELQNANKSEDKRASRAESSVHASAAS
NMNNGKPGEAAVNNAEGAACSPLKDSLWVNAPEFVPKSIATKPLSYAAAVNPTGAVGNNN
STKQLCPYANKDGFCKYPPGECSYLHGEICDLCGNAALHPYDEELRKKHRQDCIKQHEKN
MELSFAIARSKEKSCGICFEVIMEKANGEQRFGILPNCNHCFCLSCIRKWRQARQFENKI
IRACPECRVTSDFVCPSLFWVDTKEDKNKLIDDYKTALSTKDCKYFDKGVGKCPFGNKCF
YRHAFPDGRVCDVGPPPRQRRRGPGLDNAAIEVLQQVILWDFLDERDNPWQSLAEDLEDL
ADFFSDSEESDWSDYDLFIS
Download sequence
Identical sequences TC004145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]