SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004276 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004276
Domain Number 1 Region: 614-1047
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.56e-143
Family Reverse transcriptase 0.0001
Further Details:      
 
Domain Number 2 Region: 1205-1358
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.17e-35
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 289-335
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000372
Family Retrovirus zinc finger-like domains 0.00072
Further Details:      
 
Domain Number 4 Region: 378-466
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000135
Family Retroviral protease (retropepsin) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC004276
Sequence length 1490
Comment GLEAN_04276
Sequence
MTDDKNKESPKEIIPQSGQEFLNLETILQLVKAAVSEALQAQTGTVAAAAAAAAAVDQEV
AGSPDIQELSRDKEASGTLGSSGNGVVSETSGLQNSLPLGRVEAPGASRNMGYCVMPDLT
QSLRVFNGKGGASDALQWLQDIKTMAGRQFWGDAILLEVARQHLVDSALLWYRYHQDTLT
TWAAFEMRFRENYTDRRTLAERFREMSERKQRTSESAEDYFYAKMAMCRDLKLSFAETKE
MLLTGLKSREVARSLLTVRHDDEWQLLRDLRNNERLDLISVPERRILPEKRKCFRCGAEG
HISKNCNTPRVENNTKCFPCFKCGKMGHFARECQVPGRDSRERQVVGRNENSQRGATANE
VAAQVKTINAQSDNLKYFKDVKINGVEVRGYVDMGAEVCVIRDDYVPKLKLMCDWDKKKD
VTGYGGAVTSVLGAAQVDVEIDGINAQIELLVVPRETQEIPVIIGHPYTEQPHIEIVKTP
HELIIRKCEENGANNAPRTVLWASEASVIRNNFLGHITVRTQTPESTLCVEGGLRESGEW
VPRCVISTDRNGDTVLPILNISGKDIKIVENQSVARGDVCREYTHRRDVNTEPIDACEIN
TDLAGKDAEKVLELINDYRDLVARNVKQIGCTNLVEMDIELTDDKPVVYRPYRMSFSEKE
QVRNIVRELKEADIIEETDSPFASPVILVKKKSGEVRMCVDYRALNKKTVKQHYPLPLID
DQLDRLRGQIYFTSVDLSMGYHQVPMSRDARGKTAFITPDGVYCFKRMSFGLANAPSQFQ
RLINIVLGNLRYDTAMAYLDDIIIPSKTVEEGLAKLKLLFNRFRYANLTLNLRKCFFFMT
KIDYLGFTISKEGIEPGRDKLRAVAEFPVPTDVHKVRSFLGLASYFRRFVRNFAIIARPL
SDLLKKGGSFKWGVIQQNAFESLKKALMNKPILCVFDTGAYTELHTDASSTGLGAVLLQK
QNDGTLRPVSFYSRKTTPEEAKYHSYELECLAIVAALEKFRVYLLGIHFVIRTDCNSLKL
LANKKDMHPRIGRWFIRLSEFDYTVEYHRGENNKVADALSRNAVEAGRAVPVGGLPDVMG
IKINTDWVAALQRTCNETKSVLQKLEEGDQATHSKFTLCNGRVYRVKDGKWRLYVPVDLR
FDIISNAHRELMHLGIDKTLDKIKESYYFPKMREEVGKYINRCINCLYSKTPRGRQPGML
HPLDKGSTPFQVVHIDHLGPFPSSKTGNKYVCAIIDGFSKYTVLKALPDVGAEGTLSFLK
EFVSNYGKPNKIISDRGTAFISKLFEKFCGDCEIQHVKIATASPRSNGQVEKVNDVIITC
LSTSTDDIEGSDWDEKLSEVQWAINNATHSVTKRTPFSLVRTYTRDGFTNNPLAAEIRDL
NTRLNTEEEQNLVADRLKRNADRMCANFNKSRRQARVFKQGDLVLVRAEVPSTGQSRKLS
PKYRGPYEIVKFIGNDRYLVQDIEGEQQSSRFYKGIISVDRLKLVSNLEE
Download sequence
Identical sequences TC004276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]