SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004277 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004277
Domain Number 1 Region: 478-913
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.67e-143
Family Reverse transcriptase 0.0000767
Further Details:      
 
Domain Number 2 Region: 1073-1227
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.25e-32
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 3 Region: 260-308
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000194
Family Retrovirus zinc finger-like domains 0.0011
Further Details:      
 
Domain Number 4 Region: 336-435
Classification Level Classification E-value
Superfamily Acid proteases 0.000000333
Family Retroviral protease (retropepsin) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC004277
Sequence length 1399
Comment GLEAN_04277
Sequence
MFGLNGFGNESPILGVTTNSDTRNYLTMDAISSGLDERRQRSTRGNEDDTNNTGLSPVLQ
DQIAKVNFEREMLEREKDLLQKTLPDFDPGSSKTALTAIQWIRKVETIASIYGWDSKNTL
FHAMNRLNGAARFWFHGLEESLTDWHTFKTKLVEDFPVIHDDADIHFELSNRKKKFNESY
ETYVYTMKSIASKGTVSEQAVIKYIIMGLGDRELAKMLSLNDIRTTQDLLKRILQYVSTF
QRCKSLRASSPNKIETKNDFDSKHLERKCYNCNEVGHISTNCPKPQKKSRCNTCNRVGHF
AKDCQQSNQRKDTEESEKTKEKYPKVRKIESNGSNDQNYKVITIDAKEITAYIDLGSDVV
TLRKSDADNLNIVYVPYNIMLRGFGQGSCKSVGKRTLMLNIDGVLIECEVLIVPDDSQED
SMIVGRSALAQTGIRVITEGDKLSIEKVMSVSVSTNPPDDIHCNPELSKTDQEQLIQLVN
DFKTCFASNLHELGTTDLIDMNIKLTNNEVVRYRPYRLPYAQREEVDKIVDDMLSAGIIS
DSNSEYSSPVLLVKKKDGSNRLCIDYRRLNAITVKEYVPMQIIDEQLDLLSGNGYFTTLD
LASGYMQVPVAKESRHLTSFVTTTGQYEFNRMPFGLVNAPSVFNRLMNMVTRKIGRGVVT
IYMDDILIPSKTVGEGLEKLTLVLQTIRDLGLTLKLSKCRFLFTKLEYLGYEIDANGVRP
GSRKVNAITDFPRPTNVHEVRQFLGLCNFFRRFVQDYAKIARYLTLLTKNDQRFIWSEDQ
ENAFLTLKKILSEKPILSLYDPTAEFQVYCDASKQGLAGIYLQKKKVDAVWKPVCYFSRQ
TTEDEKKFHSYELEALAVVESLDRFRVYLLGRKFTVITDCNSLKTMMTKRDMSPRLGRWF
LKLQEYDFDIQHRAGSRMQHVDALSRNPTEPAREVEVADAKIYSLRIDMSDWLLTMQLQD
KKIVDIYETLKRKPTTNIEKQIHIDYSIENNRVCRKIGTNLRWVVPKPVIWKVIQSCHDD
MGHCGVDRTVSYLQKYFWFPKMRKKVQTYINSCIRCAYHKTQKGKPEGELHRIERTPIPF
HTCNIDHLGPFVSSNRESYVLHYQDNFTKYALFRATRNTKSKPVIDALKDIFAVFGAPTR
LICDRGTAFTSKEFTLFCEENQITLIKTATATPRANGQVERKNQTLLEALRTTFNREDYK
DWSQHLRNLQFALNAHKNKTTQMSPHDLLFSYHPRNAVQNQLILALGEPDDEINLEEARE
EAVRKIHRQQAKDKQRFDEKHKRPTEYVEDDLVLITRNPVPTGEPTKLQPKRKGPYLVSK
VLGRDRYLLTDIPGAQRSQRPFRSVFSSDHMRPYCKLLESDEDESDDERVEDDPNGSGPN
CQITAATSLDPSASGGRRK
Download sequence
Identical sequences 7070.XP_001810078 TC004277 XP_001810078.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]