SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC004956 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC004956
Domain Number 1 Region: 103-465
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000102
Family 28-residue LRR 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC004956
Sequence length 475
Comment GLEAN_04956
Sequence
MSPKNQVHPLSYLCVKLVSAQLIQALSDDEGRNYDVVLEYLFDATYEVVQELLKNILNSV
NLDAATRFSCLQVLLRQDVRKLDTGIFPHSYYEAILKVITQKGTGLQQLNLKGVWVRDHP
AQLSELVTNLTKLKILVIPHMADDQVLQAISKAQSLSVLDISGECSFTSSGLRLIRNETL
TCVDIGYFGKKSICQQDESDCDIIAEMIENLPNLTCLRTYSFTGTSLLTLYRKNSKHKTR
LKYLHDTGTSDEVIEAIINMCEQLKSIHLDTPQKGVICRLKQLKKLNCIKLVHHDSADLL
DYLADSGAALQVLKLNHNKRNALDLCDVCLCVPNLHTLECFQLKLAFSQMDTFFMNLENI
EILYCDVSDSSLKCILMNCPFLKRVIIGCVINMTDGDVFRLCAECDFLCLEELWLSCARG
LTCISVELLMGHCPNLKVLGQLSGWDIHQEEIEYLRSVILYTNTDLTLLPLGTFS
Download sequence
Identical sequences D6WCY7
7070.XP_969309 XP_969309.1.52716 TC004956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]