SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC005119 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC005119
Domain Number 1 Region: 94-214
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000000000222
Family CRAL/TRIO domain 0.0037
Further Details:      
 
Domain Number 2 Region: 305-437
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000000000314
Family CRAL/TRIO domain 0.0027
Further Details:      
 
Domain Number 3 Region: 21-82
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000994
Family CRAL/TRIO N-terminal domain 0.0093
Further Details:      
 
Domain Number 4 Region: 230-291
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000118
Family CRAL/TRIO N-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC005119
Sequence length 470
Comment GLEAN_05119
Sequence
MDLLRVTSDERTQILKLYNVDNTRLKQDIEMITTWKSKQPHLQVDVSDEFLEKLLLKNKF
SVERCKEKLENYYTLRGTNKDLLEGYEKILPSQEALTFLPLPQLTQNYERIIVMKLINTD
PKIYDLVRVFKFAVSLNEMMLRHDGSLGIRVLIDYTGFTVKHLATWNPVILMRYYSLAEI
KLHENLESLYKVIPKKYLPEDYGGTNGKISDLLVTSDERTEILKLYNIDNARLKEDIEVL
KIWKSKQPHLEKNLSDNFFEKLLLKNKFSIERCKEKLENYYTLRGKNKDLLEDYEKIVPS
QKAVTFLPIPELTRNYERIVVMKIINPDLKTYDLVPAFKLALAVNEMMLRHDGSLGIRLI
LDYTGFTLKHLSTWNPIILMRYYNLAEIKLHENLESLYGVIPKEQLPKDYGGTNSSISNL
LEKWDEEVEKQQSFLLECANTIANEDLRPPESQENDLFGTGGTFKTLSLD
Download sequence
Identical sequences TC005119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]