SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC006460 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC006460
Domain Number 1 Region: 242-514
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.5e-80
Family Mitochondrial carrier 0.0000572
Further Details:      
 
Domain Number 2 Region: 21-175
Classification Level Classification E-value
Superfamily EF-hand 3.43e-31
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC006460
Sequence length 524
Comment GLEAN_06460
Sequence
MPNKLSQYEDIPFSHRPPHYLHELPIEDEERLGKLFKQLDKDGNGKIDIHDLSEALKEHG
VHHHYAEKFFQNSRSKSGDLSLADFIYYVREHEKNLRLHFSHIDRNKDGRIDLDELIKAF
SDLGIPLDTMEAKKLLQRMDQDGSLNISYDEWRDFLLLAPNSQDIHQLISYWRHSTCLIY
LVIVEKNCDRKMYEQELAPASIPDVLEDCIYLFRELIKYLDIGEDMNVPDDFTQSEMQTG
MWWRHLAAGGIAGAVSRTCTAPLDRLKVFLQVQPTKQRIGDCFNYMLKEGGVTGLWRGNG
INVVKIAPESAIKFAAYEQIKRLIKGDSKTGLSIYERFCAGALAGGISQTAIYPLEVMKT
RLALRKTGQYKSIMDAAFKIYHLEGIGSFYRGYIPNILGIIPYAGIDLAVYETLKKKYLK
THSNLEQPSFWMLLACGSVSSTLGQMCSYPLALVRTRLQAQVAHPSMDPSAITMTGVFKT
ILEKEGVLGLYRGITPNFIKVMPAVSISYVVYEYSSRLLGVNMT
Download sequence
Identical sequences D6WWZ5
TC006460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]