SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC006870 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC006870
Domain Number 1 Region: 622-1046
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.11e-156
Family Reverse transcriptase 0.0000217
Further Details:      
 
Domain Number 2 Region: 1196-1348
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.98e-39
Family Retroviral integrase, catalytic domain 0.0082
Further Details:      
 
Domain Number 3 Region: 447-559
Classification Level Classification E-value
Superfamily Acid proteases 0.00000003
Family Pepsin-like 0.046
Further Details:      
 
Domain Number 4 Region: 371-412
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000251
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 
Weak hits

Sequence:  TC006870
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily SAP domain 0.0897
Family SAP domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC006870
Sequence length 1488
Comment GLEAN_06870
Sequence
MSGTDDELDSDTEAGDIRVGWIYRLRKQELISDLKRFGLSTEGTVEELRRRLRQFVKENA
AAVGTTPEITNTESTMTAFTTTYVPNVFSFNVPPQAGTVPRGYTGINTSTTQVEGWYTRR
PATEMPQPTFTYPAPRLSSLETQPVINPVAHLDFVNQIRKWNVTFDGKNDAVSFLERVEE
LAEEYMIPKNHLVRALPELLRNQAILWYRNQKSDIHSWNDFVRVFRAFYFPREYREGLEE
EIFRRVQRPQENGRDFVIQLQTLIRRHGGWTRDQELNCIYKHLLPEYRQYIRKNDVRSVM
ELLDQIQEYEGLTQEIRRSKSDVKSCMSTTSNWTKAKPGFSMSTPQQTSLQRPKPAPRPT
WSSNSNKQSDLERLCWRCGQKGHTRLQCRQPAILFCSRCGRQGVKSIECPCPFKPGNSKG
TAPEKGSDQSPELGAITGTPYPIGQVFPDFANNSRVLWKIVVENQEIPALIDTGSVLSYI
NEETAKHCISQGLQPQFLSSRMQAKMANGVTVDTNLFFNIKFQASDLEFSCDFLLCPNLT
SPMILGLDFIMEQQLVLNFETGEISRQGQVLVCVKTPLTLVTSERTDSDVSTAPSEPVET
ATATVDTAIVGDGFVEREIKNFAEVQGRTDMTVHEIRLTNPTPIKQRYRPQNPAMQQIID
EEVDRMLTEDIIEPSESPWSSPIVLADKKDGRKKRFCIDFRKINSVSQKDAYPIPHINGI
LDKLRGAKYFSKIDLKQGYWQVPLAEESKPITAFTVPNRGLFQFKVMPFGLHSAPATFQR
LLDRVLGPEMDSGAFAYLDDIIVLGRTKEEHQENLATVFRKLRKAKLTPNWEKCSFGQTR
LEYLGHIVSSQGVSTDPSKVKAILELPPPTNVKELRRFLGIASWYRKFVPVFSQVAAAVN
RLLKKKQKWEWGNEQKEAFEKIKQLLTEAPVLACPDFTKTFVLQTDASDLGLGAALIQNL
DGGDRVIAYASCSLSDQQTKYSTTEKECLAIVWAIQKMRPYIEGYHFVVESDHQPLKWLM
KQPEPKGRLARWIMTLQQYDFEVRYRKGVLNQVADALSRNPMPQKSGIEAIETAHPIDRW
YRQKYEEVSATPDLFPDFKIENDRLYKHIMNSQGLTGAQEWKLCIPKGQRKQVLFENHDV
PTAGHLGIAKTTARLAQKYYWPGMFREAAKYVQSCENCQRYKSSQQARPGLMQPYKIYEP
WHTVSVDLVGPLPRSSKGNSYVLVCQDRFTKWIEVQPLRRATAPVVTRTLYENIITRFGC
PKRIITDNGTQLESRLLNKLMKDFHIKHRLTPPYTPQANPVERANKVLKTMIAQYCEENQ
RKWDENLCSFRMAINSSKHESTGFTPAYLNLGHELRMPSALLQEDKNEEIGFDPETEDAA
IQEYPKRIQELQEQFELVRLNLSRAFTTQKKYYDRRRREWSCHPGDRVMKRDHVLSSAAR
GFAAKLAPKYSGPYIITKVLSPVVFNLKHASSGQILKNVHIKDLKPAH
Download sequence
Identical sequences TC006870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]