SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007149 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007149
Domain Number 1 Region: 20-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-36
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 474-581
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 3 Region: 263-323
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000994
Family VWC domain 0.025
Further Details:      
 
Domain Number 4 Region: 325-389
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000146
Family VWC domain 0.04
Further Details:      
 
Domain Number 5 Region: 698-752
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000785
Family VWC domain 0.014
Further Details:      
 
Domain Number 6 Region: 426-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 389-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000708
Family EGF-type module 0.043
Further Details:      
 
Domain Number 8 Region: 589-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000603
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  TC007149
Domain Number - Region: 762-799
Classification Level Classification E-value
Superfamily FnI-like domain 0.000345
Family VWC domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC007149
Sequence length 874
Comment GLEAN_07149
Sequence
MSTTGLDPTGLLSSATSPDQSIDLLGALGSHNSSWAGVTLAQGPQQIRPAYYLQGDYRDL
KLPAAAFQQVSDLLRRSPEFTISAWLRQEVGNTGSIVSFAHGLNRYLELQSSGRKNEIRL
HYTSRVDSKVYVETFHYRLADNLWHHVAVSVSGSQAELLVDCHPLYKRLLRPGAPDRNFT
EPQQLWLGQRNKHYHFKGAMQDVRLIGGPHGYLSLCPSLDSTCPTCGQFSLLQNTVQELT
RHLQELSERLVAAEGRISKVEECDCQKSCHVNGTVHADGATWQRGCDLCACVHGEVQCRP
VECPELPCKHPVNISGECCQSCLRHCLFYGAFYDHGELVTIKKCVECECQDGSMQCTRID
PETMCPKLTCPPDEQFSVADNCCKFCPGVDYCAKGHVCHANATCLNLQTTYACQCDQGFQ
GDGRLCTDINECQQEGGLEGHHCHQNTRCVNTPGSYTCECLAGYRRVDKFNCAELDECSS
GEHNCDVNADCINTQGSYHCVCKEGYTGDGYNCQPVCNQSCLNGGICRSPGKCACPNGYT
GSSCERDLDECATNAHRCTEASVCVNMIGWYYCKCKEGYQSPVSDNNLGTLCQDIDECVD
ELHTCHPTAQCVNVNGGFRCECPPGKEDCRLSCMFEGTELAHGLSLSPQKDPCQTCTCNY
GVITCDKPHCNCSLPGSSQNPCCPQCDKKHACKHQELTDVVLMHGEQWSYQCQTCECLYG
EVDCWEMKCPPLLCDNPVQAIGDCCPHCDDLCPLGNASTWGQPCTFAGRMYESGAQFADP
NDPCVSCNCKDGVLCCSYNYHCGNDTHAVGFDGVVASTGGAKGHSGGGTGEASAVSDFTK
QYSAALRVANSSAGVVYVSDSMGGNKTEQSPPGG
Download sequence
Identical sequences TC007149 7070.D2A148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]