SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007542 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007542
Domain Number 1 Region: 586-963
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.52e-118
Family Reverse transcriptase 0.00067
Further Details:      
 
Domain Number 2 Region: 1118-1274
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-33
Family Retroviral integrase, catalytic domain 0.0096
Further Details:      
 
Domain Number 3 Region: 326-423
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000109
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 
Domain Number 4 Region: 264-306
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000136
Family Retrovirus zinc finger-like domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC007542
Sequence length 1418
Comment GLEAN_07542
Sequence
MGRHRYRGNVDSDDSDSSDDEPRPKRSAPGVSTTVNSPPVSAESARIARLEQLVENLNRR
LLNRNFEHTSGQVGIKSDLIPEFAPGNPNFSTTKWLHKIDQLALVNGWDERTTIYGMISR
LKGLAKEWYDNLDPSAYDRSWDEWKRLLQATFPDHHDYASTLRKLVNRVKEDGETWAQYY
FGKLNLLQACDITGTNAVSCLIDGITDVTLRNGARAGRYVTPESLYAEYLSTLRSEGDKR
DTLAKQAPRERRRFLPSRVEAQKLYSSVRCYNCRNRGHVATKCPKPRIECKKCGRIGHVD
AECRRGNVVKENMSKQALTTSVADASNNKNYYIDIKVNGKPTRAYIDSGAEPVLVKQSVA
RELGLMWQPSLHLIRGYGQGITKVHGEVEVELEVDLVKANVKALIVEDSAQRVPVIVGQT
FLNAGANTIIANEEAVRVVDGNNESIQAFLGQLPTRKVALWAEEETVIPPQSIGCIRIKA
KDDGWKGAYYVEWCQRPRPGFEHVVHRCVTCDGGLVTVRNLSHQDLVYRKAQIVARAEPC
EQERTATTVSVFSVGKVEVKSFQRWELLTQVNKNLDPAQFEQLLQLVNEFRDCFARNVAE
IGATTAAEMKLTLTDDKPVIYRPYRLSHHERRIVRDIVNDLLGSGVIRESDSPYSSPILL
VRKKDGQHRMCVDYRQLNSKTIKDRFPLPRVDEHLDKLNDLASGYYQIPMATESIPKTAF
VTPDGHYEFVRMPFGLANAPAVFQRAMNKVLGPLRFQTAFCYIDDLLIPSKDFETGLNNL
RTVFQLLRQFGLTLKLSKCCFFGSQIEYLGHEISAEGIKPGETKIKAVTAFPKPTDTLKD
ILTSRPVLAIYDAEAETELHTDASKVGIGGILLQRQGDGSLRPVMFFSRQTTKEEQRYHS
YELETLAVVCSLKHYRVYLLGLQFKVITDCNALRTTLTKRDLIPRIGRWWLLTSEFDFTV
EYRPGSKMSHVDALSRNTVLDPSEPSVEVLHINVNDDDWILAVQMKDARCALLKEILEKS
PTNAEERAIHKEYKLKDGRVFKQTESGLKWVVPKAVRRQILLAHHDGIGHLSNEKTLASV
SKSYWFPSMRRYVHKYISSCLECLYNKEAGGKQPGFLNPIPKNSQPLDTLHMDHLGPFVK
SKSHNSYLLAIIDAFTKFVFLRAVPNTKVGPVLSFLASLTGMFGVPKRIIADRGACFSSK
KFKTHCTDLNVKLVLTATATPRANGQVERLNRTILSQLAASSREEEKWDDFVSRISWGIN
STPNSTTGKSPYELLLGYTPRHANDSILTNVVTEGVHDGDLPRTRADVAQRVEKEQQKQK
ERYDKRRCAPKRFNAGDLVLVRTTRASNEGKSRKLLPKYSGPYRIQKVLDYDRYVVTDMP
GATRSQKRYEGVHSVDKLRHYVVATTSGDETMDDVSDE
Download sequence
Identical sequences 7070.D2A3B8 TC007542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]