SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007546 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007546
Domain Number 1 Region: 586-1020
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.4e-151
Family Reverse transcriptase 0.0000382
Further Details:      
 
Domain Number 2 Region: 1175-1331
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.05e-33
Family Retroviral integrase, catalytic domain 0.0093
Further Details:      
 
Domain Number 3 Region: 326-423
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000113
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 
Domain Number 4 Region: 264-306
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000144
Family Retrovirus zinc finger-like domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC007546
Sequence length 1475
Comment GLEAN_07546
Sequence
MGRHRYRGNVDSDDSDSSDDEPRPKRSAPGVSTTVNSPPVSAESARIARLEQLVENLNRR
LLNRNFEHTSGQVGIKSDLIPEFAPGNPNFSTTKWLHKIDQLALVNGWDERTTIYGMISR
LKGLAKEWYDNLDPSAYDRSWDEWKRLLQATFPDHHDYASTLRKLVNRVKEDGETWAQYY
FGKLNLLQACDITGTNAVSCLIDGMTDVTLRNGARAGRYVSPESLYAEYLSTLRSEGDKR
DTLAKQAPRERRRFLPSRVEAQKLYSSVRCYNCRNRGHVATKCPKPRIECKKCGRIGHVD
AECRRGNVVKENMSKQALTTSVADASNNKNYYIDIKVNGKPTRAYIDSGAEPVLVKQSVA
RELGLMWQPSLHLIRGYGQGITKVHGEVEVELEVDLVKANVKALIVEDSAQRVPVIVGQT
FLNAGANTIIANEEAVRVVDGNNESIQAFLGQLPTRKVALWAEEETVIPPQSIGCIRIKA
KDDGWKGAYYVEGCQRPRPGFEHVVHRCVTCDGGLVTVRNLSHQDLVYRKAQIVARAEPC
EQERTVTTVSVFSVGKVEVKSFQRWELLTQVNKNLDPAQFEQLLQLVNEFRDCFARNVAE
IGATTAAEMKITLTDDKPVVYRPYRLSHHERRIVRDIVNDLLGSGVIRESDSPYSSPILL
VRKKDGQHRMCVDYRQLNSKTIKDRFPLPRVDEHLDKLNGAKFFTTLDLASGYYQIPMAT
ESIPKTAFVTPDGHYEFVRMPFGLANAPAVFQRAMNKVLGPLRFQTAFCYIDDLLIPSKD
FETGLNNLRTVFQLLRQFGLTLKLSKCCFFGSQIEYLGHEISAEGIKPGETKIKAVTAFP
KPTDVHKLRQFLGLCGYFRKYVKDYATIANSLTSLLKKGSAFVWEEAQERAFQTLKDILT
SRPVLAIYDAEAETELHTDASKVGIGGILLQRQGDGSLRPVMFFSRQTTKEEQRYHSYEL
ETLAVVCSLKHYRVYLLGLQFKVITDCNALRTTLTKRDLIPRIGRWWLLTSEFDFTVEYR
PGSKMSHVDALSRNPVLDPSEPSVEVLHINVNDDDWILAVQMKDARCALLKEILEKSPTN
AEERAIHKEYKLKDGRVFKQTESGLKWVVPKAVRRQILLAHHDGIGHLSNEKTLASVSKS
YWFPSMRRYVHKYISSCLECLYNKEAGGKQPGFLNPIPKNSQPFDTLHMDHLGPFVKSNS
NNSYLLAVIDAFTKFVFLRAVPNTKVGPVLSFLASLTGMFGVPKRIIADRGACFSSKKFK
THCTDLNVKLVLTATATPRANGQVERLNRTILSQLAASSREEEKWDDFVSRISWGINSTP
NSTTGKSPYELLLGYTPRHANDSILTNVVTEGVHDGDLPRTRADVAQRVEKEQQKQKERY
DKRRCAPKRFNAGDLVLVRTTRASNEGKSRKLLPKYSGPYRIQKVLDYDRYVVTDMPGAT
RSQKRYEGVHSVDKLRHYVVATTSGDETIGDVSDE
Download sequence
Identical sequences XP_015834401.1.52716 XP_015834402.1.52716 TC007546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]