SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC007552 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC007552
Domain Number 1 Region: 541-675
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.67e-28
Family Reverse transcriptase 0.013
Further Details:      
 
Domain Number 2 Region: 805-923
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.48e-23
Family Retroviral integrase, catalytic domain 0.009
Further Details:      
 
Domain Number 3 Region: 326-423
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000075
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 
Domain Number 4 Region: 264-306
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000972
Family Retrovirus zinc finger-like domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC007552
Sequence length 1059
Comment GLEAN_07552
Sequence
MGRHRYRGNVDSDDSDSSDDEPRPKRSAPGVSTTVNSPPVSAESARIARLEQLVENLNRR
LLNRNFEHTSGQVGIKSDLIPEFAPGNPNFSTTKWLHKIDQLALVNGWDERTTIYGMISR
LKGLAKEWYDNLDPSAYDRSWDEWKRLLQATFPDHHDYASTLRKLVNRVKEDGETWAQYY
FGKLNLLQACDITGTNAVSCLIDGITDVTLRNGARAGRYVTPESLYAEYLSTLRSEGDKR
DTLAKQAPRERRRFLPSRVEAQKLYSSVRCYNCRNRGHVATKCPKPRIECKKCGRIGHVD
AECRRGNVVKENMSKQALTTSVADASNNKNYYIDIKVNGKPTRAYIDSGAEPVLVKQSVA
RELGLMWQPSLHLIRGYGQGITKVHGEVEVELEVDLVKANVKALIVEDSAQRVPVIVGQT
FLNAGANTIIANEEAVRVVDGNNESIQAFLGQLPTRKVALWAEEETVIPPQSIGCIRIKA
KDDGWKGAYYVEGCQRPRPGFEHVVHRCVTCDGGLVTVRNLSHQDLVYRKAQIVARAEPC
EQERTATTTLKDILTSRPVLAIYDAEAETELHTDASKVGIGGILLQRQGDGSLRPVMFFS
RQTTKEEQRYHSYELETLAVVCSLKHYRVYLLGLQFKVITDCNALRTTLTKRDLIPRIGR
WWLLTSEFDFTVEYRPGSKMSHVDALSRNPVLDSSEPSVEVLHINVNDDDWILAVQMKDA
RCALLKEILEKSPTNAEERAIHKEYKLKDGRVFKQTESGLKWVVPKAVRRQILLAHHDGI
GHLSNEKTLASVSKSYWFPSMRRAVPNTKVGPVLSFLASLTEMFGVPKRIIADRGACFSS
KKFKTHCTDLNVKLVLTATATPRANGQVERLNRTILSQLAASSREEEKWDDFVSRISWGI
NSTPNSTTGKSPYELLLGYTPRHANDSILTNVVTEGVHDGDLPRTRADVAQRVEKEQQKQ
KERYDKRRCAPKRFNAGDLVLVRTTRASNEGKSRKLLPKYSGPYRIQKVLDYDRYVVTDM
PGATRSQKRYEGVHSVDKLRHYVVATTSGDETIGDVSDE
Download sequence
Identical sequences 7070.D2A3A8 TC007552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]