SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC008967 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC008967
Domain Number 1 Region: 1458-1713
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.84e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000895
Further Details:      
 
Domain Number 2 Region: 296-539
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.55e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000721
Further Details:      
 
Domain Number 3 Region: 1728-2000
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-47
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00013
Further Details:      
 
Domain Number 4 Region: 907-1077
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.02e-35
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00054
Further Details:      
 
Domain Number 5 Region: 802-860,1150-1177
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000698
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC008967
Sequence length 2003
Comment GLEAN_08967
Sequence
MWVHKWLCFNLYIFAKTLVILAEVITLIDEEEVTCVFTEEDVYSAFYIWKMEANLPILPM
RNQTPELSDWGQDDWTVSTSYLPITDIRWENTIKYSNTTTREIASYIKLPQSSNVCISLF
VSIDEGCYLNITTNTNTTKVEGFNKKDALKSWKRIEIPTDNLKAPGILSFHRGRNDNNTT
GYWAIRDIRYCRPKKLVEIFTHKRNGNAKHICKTLNSTYLATQKFCDDNEVLIALYCNYY
APIKFFKRENWYRRRDRTVFYVTRAHKISETFELHEQVPMIAQNDEKGRSIKINGFEDYL
FKNLEDNPDDNEITRQYQANDETRVILRESEDGNDYINANFIDGYETPQAFIATQAPSSG
TVEDFWLMICEQNVSIIIMLTELRENGRIKCVQYWPDFQSRCRFGKISLENISTKNFPHY
SRREIKIHYRNRTYFVQHFQYVTWPDHGVPLCRQGFTNFLKEIMEIPQTSPIVVHCNAGC
GRTGTFILCAIAISVAKKENEVNFYKLLKHMREQRPRVVTTADQYIFAHFVVLEYFYGKD
FSIPITANFKDKVQSAIEERALNNLADQIGKALTQYLRTKFQLNHQLTDEEKAKNRFSTI
LPDTINYSNNVSTKIRPYIKLQQFENSCISLFVSVDEGCYLNVTLNSNTTEIKGFNKKNA
LKFWKRIEIIAEKVKPPGKLSFHRGRYDSKTTGFWAISDVRYCRPKTGNRTKDVTEKTFQ
VIEIYKTTISSVNKIFGNNKYICKTLNSKNSLNHKFCNGKVESKKTKTTKWNVSPQVSAL
TLEEGRSIHNKESKNMNFAESEAPQNLHLTTSDDNAYINWEHPFVINGPIRKFYVVIKTN
GKIENKTVNVKKTQKSYKYKQIQYSDNKNQRELRARKLKNKKTHYDNIVTGDEALLGMKN
NPEMSSLIHLEDFEQYVKNAAMTGKLTREFRGFDRPKVYIATQGPKFATIRDFWRMIWQE
QADTIVMATNFMEDKKRKCGEYFPQRLGTLCEYGEMRIKLVSERLFEHYDSRIFVVSYRE
SERRIQHFQMKWSPDDLKPLYANCLVPLVKRIREIRMNSKKPMKQYVLAHLVVLECLTEE
KHTLKKAVEENFSETFLKTQLNHIERLQWLDDVVKSSNQPNNKAPSYRYLVLTKNLQWRR
KFCEERALGKETVVDIRNIAEYKVQNLEPFTEYLIELYNSNQRPVIANIKGTTKPDKQIT
EKELPTKFQFSKDLLTLQFEDCQYFNGPLSYDFSFQCVSTWCKKDQKIHKQLNMTSHVKT
LTYNTTRFLPFTDYKLAVKASRFDSHIEKEYNTERTGPKENKHNESDKRTLSSLELIDDY
FHVELGDEPDQVVSLENETYRMSLVINKSVYPFIEKKYQTASLAGLVALCTVSFVTVIFL
CYLFYAKNSEGNKDDEWIIMEFSERYQRNSIKRVRPKCDSPPKAEELEVLAQTSTTTLKI
DHFEDYLMHSLGEDPKDNDLTKQYQAIPNPTKPRTVGLLKRNVAKNRYKNIIAFDETRVK
LKDYDGYDYINASYVDGYKVPRAFIATQAPMESTIGDFWWMVWQENVKNIIMLTELVENN
VEKCAQYWPELKSHVRYGKILIRNTYQKIHADFIQRKLSVRCNNENRTIQHLQFVTWPDH
QVPLYPQNFTKFVRTMVAMPLNKSRIVVHCNAGCGRTGTLILCDTVLRMAAKETKLDFVK
TLTNMRQQRTNLVSNVDQYIFAHFIVLECLFEKNFSIRIDDSFQDEVMKVLRKTTVKPLM
EHLDKVMMQFKKREVKLSGSITDEDKTKNRFSDILPGNAKVFLQTSSRHTSSYINAVFVD
CYRCPKKFIVTQQPLPNTLDDFWRMIKYREINTIVSLNEIDGSDPRCPKFWALDTDSTSL
EILEENNNKTYSTTKLKIMDKRDTSVDKIINVLELKNWKRETPQPKNVKDLIMVWREMFS
NSWKGTSQIVVTCYDGATASGLFVALAFLLEKINYEQECDVFSAIRAVRQSREQFVQEWG
QVEFLYKAAKLYVEEFDNYHNFN
Download sequence
Identical sequences TC008967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]