SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC011194 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC011194
Domain Number - Region: 35-119,321-476
Classification Level Classification E-value
Superfamily RNI-like 0.000184
Family 28-residue LRR 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC011194
Sequence length 551
Comment GLEAN_11194
Sequence
MAPRCIRYKRTIDLCKAYTLPDLVELSKKIVFENVTTLNVNCLYWVSASKLRRLVRRLIN
LETLYAMQTNLSLTSYDTEVFSKLKIKKMSVSVDRHEGINSHKIPTIETLYLSVIEVTAF
INPWVLHMVFPALKNLWIDVEKPCDPKIILHCLHAGNKNKIFFQVKARTPSINFDHYGLS
TYYNNRRASQPYVMCCEKFTAKQLPSESIFEIERSSEESWRILDELHCSKPYGPDDARKL
FLNESNVDTMFFEELNFYHNGPVCNDRCRNAVSQILKSSCSSKLNKLCIMMCLFENKDAQ
EAVKTEDSYRATRERIGIMNKTANHPMEGVFKNFQGLQHLEVFACNQTSHHSAIQAYPLI
TIFEHLECLKVEIPVTLDGSFLIDVLKKCKHLKRLLITSLSQNEKLNMNLALAIPNATSL
KDFRFQNHRIQLDKLLQRFSLIKTQKLERIVLICEEIDKMNLPSLQEFFDTHPQLIFVYF
LIRGSTEAVVRTAQQMLNFYKKKHPSKFFLVKKIDVFNRIRFEIPNVHLCEMVKSDNRVA
SLNALDGFVNF
Download sequence
Identical sequences TC011194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]