SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC011707 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC011707
Domain Number 1 Region: 175-416
Classification Level Classification E-value
Superfamily vWA-like 7.23e-79
Family Integrin A (or I) domain 0.000000447
Further Details:      
 
Domain Number 2 Region: 414-505
Classification Level Classification E-value
Superfamily Integrin domains 2.51e-17
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 3 Region: 687-767
Classification Level Classification E-value
Superfamily Integrin beta tail domain 7.06e-17
Family Integrin beta tail domain 0.002
Further Details:      
 
Domain Number 4 Region: 591-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000977
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 5 Region: 38-92
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000046
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  TC011707
Domain Number - Region: 647-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00226
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number - Region: 551-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family Integrin beta EGF-like domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC011707
Sequence length 842
Comment GLEAN_11707
Sequence
MLFSSNRDYHKWMLVHITLLIGALLAGIQGQILQQFTQNPCDSRSTCHECIATPSCAWCY
DTVNINTTKRCFQPSYPLPPLDKCDPSKIYNPDNEMIIISNRALSSRTEGEGGTLITEEE
QTGGFGGGGGAGGGINQGGGAWESGGTITQVRPQRIKLKLRARQTYSVNMYYTQAEDYPV
DLYYLMDLSKSMEDDKEKLSALGDHLAQTMRNMTSKFMLGFGSFVDKVVMPYVSTIPEKL
RHPCTGCVAPYGFRNHMTLSTNTTSFSHMVKRASVSGNLDAPEGGFDAIMQAVVCREQIG
WRDQARRLLVFSTDAGFHYAGDGKLGGIVKPNDGECHLDQRGYYTMSSKQDYPSISQINT
YVKKNAINVIFAVTAEKKEIYEQLKEHIEGSSCGKLSNDSSNVVDLITEQYQAISSTVQM
KHNASGSVKVRFFSKCLDSKGREIETNKCGNIKVGSLVQFRVQLEVVECPSDPRDTKQLI
QIYPVGLNESLLIDLTMLCDCPCEHEGFERNSPKCHNHGTYMCGICDCIEPAYGPYCECN
KDGTSANISTANCINPKNGLECSGRGNCICGKCECEQRNNPEEAISGELCQCDNFSCERH
NGLICSGPEHGTCVCGVCECKEGWMGDNCACRNATNLCIKPDSEDPTLICSGNGECECGI
CKCRETDEGRYFGRFCEHCPFKNCSDDCEKYKECVQCQQYQTGNLTEEECRKCPFTPTSA
RVVEVDEKNGEVLCPFYDEDDCRFSFVYYFDEENKIQVRAQEERECPATVFLLGIVLGVI
AAVVLLGMAILLLWKLFTTIHDRREFAKFEKEAMMARWDTGENPIYKQATSTFKNPTYAG
KS
Download sequence
Identical sequences TC011707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]