SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC012104 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC012104
Domain Number 1 Region: 64-158
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000905
Family F-box domain 0.0025
Further Details:      
 
Weak hits

Sequence:  TC012104
Domain Number - Region: 142-235
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 0.0481
Family Guanido kinase catalytic domain 0.014
Further Details:      
 
Domain Number - Region: 223-337,433-479
Classification Level Classification E-value
Superfamily RNI-like 0.0667
Family Rna1p (RanGAP1), N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC012104
Sequence length 540
Comment GLEAN_12104
Sequence
MQKGCWKVDDNDEGTVSNTFYKRDKHHKFSHELWTEMYKSKNTGSKAVYIDLEDEEQRDE
DRQYSQWSELPDLLLEKIFSYLSIREKYYASLVCKSWYRAFHLPYVWSQFVLEDNTLTRG
RFNYYSGWQYVLDHLRTQNCLSQVGRNFRKLTFEPMLNFYNLYEFMNMVSWCTEQSQNND
NPEFGVGKNIHTLKFTFPCNMTNRDDTERIRLFGTGGKLLAALKRLMSNLKKLKRLELID
LMLDPKEAQFLLDEVCESCCMTLNTLSVINTTRVQYELFHVGVFLNLQVKGAPMIIFTRL
GDETSLYISPQNLGDDIIELLSHTKIRHIHILQNRYTPNDINMKPVDFKTWKLARKNNPE
LRVHLQIESLKEKPLIWQQGAPVSTVLYDSPHIMLREDALMTAIEFYKDTLRVFGHKNIP
RFHRNKSFYERVDSSLMLLVRQCLHLNTLIVTERISTATALLLAYTGKNLKCLFIRGNAV
IIRCDWPQNPDWSDEFYTWLKINSRSYELVEQEISQIMGRRWQFLSDKQFKKLHCNLHEF
Download sequence
Identical sequences TC012104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]