SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC012615 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC012615
Domain Number 1 Region: 1209-1404
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000405
Further Details:      
 
Domain Number 2 Region: 76-179
Classification Level Classification E-value
Superfamily PDZ domain-like 1.86e-17
Family PDZ domain 0.025
Further Details:      
 
Domain Number 3 Region: 916-970,1047-1113
Classification Level Classification E-value
Superfamily PH domain-like 9.03e-17
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC012615
Sequence length 1997
Comment GLEAN_12615
Sequence
MAIRPLWTSYFRYVTRRMGDVREDMKVEFLVVCNKVGGRFNETFHRAQETQVEHKFPNPA
RIAAAAAAPLRRGPKKLLIKRNGDSFGFTLRHFIVYPPDSIAESDDRYAAVGALSAPMDT
IFVKNVKDPSPAKRAGLQKGDRLVKVNDVLVTNKSYAQVVQLIQNTPDCLQLLVVPKEDD
ILQRYFAETAYNPASNQLPSRFVNDHQAAQQFLTQTISQPPEFQVDALSWRSLQSPYGYD
YRQPLHERSQRSAENLDLNDRLTYQPNDPFRRQRPRAQPQVPPYRNMGRRASDGCALSDR
EYYSDYSDLNDMKTIHKPSYLQDNQNSEMPGLRYPNAAGCRLSLDAGRRESSSSLTSSLA
DGSKDSLTSFDSTSTLTGQETDDSARMSRFRKSVQQKEEFLKMPTDTSVKPREFYSRPNK
LERAMWPPAEPARQESPSKTKPTHQNFQRVKNDIENERDLLQSSGGVPRNLPQQKGAKSP
NDKPSMATNDRMKEASVAPSSLDNVEQLNGSFTAENSDISDDKRLYPTSLQMVHKRARQF
ESGKPENDPQVSDRTLYFKSEIARFSSKKIVPNVTERAQEFETRSEPTNRETPATTISPK
RIQRDSRSLDSNGSTGSNTSLGETIAKRLSGNVMISTGSKYIHCPPPSEYGKPTEASENQ
ANRICARSNSAESWVIVDSPEPSKRISRQDAIVDDGNKSKDHQVDDPGQIPYADLPPLIP
EPVEHMHFTPSVSITPAPTVLVPQPSKAVRPNQLDLEGPVRPSRHLKPPSSSVDTPMRRP
VSPVIGEDNKAAVVKRRTKNTNLADDERTTRRESYLKATEGGRMPFDSDMSDSDVSPQVL
RSLWCRCIIVNLLLAFSAHRRWRPPLFPGDIQQLRKLFEDAASSLGGSASGNSSSSASLD
REKSNASPLDKDKHPVIREGPLHCKITEIDGKRSGDRSWKQIWAALKGPKLFLHKDKHHQ
RWLYLAPSPIERRELQLCGNESEIMNVLTEQHRNKSGTVSCIPLQLNLNFSTHAFFPRKL
RRWGSTGSWSPMGTSDAVEHSLASGVDMRASEVRVADDYTKRKHVLRVSSVNPCRSEFLL
QAENTEEFTDWFKALQEQMATNTEAEAKFDPSTGSKQQAVPQTIPASTSILVQGNSRLSP
QPTKCKSSTSRNRSPTGQSPVSKNRKPSQVADPSTSPKVKTWRGRVAQQFRRMQGASSPS
SPTAPEGSTFGIPIEQCLTSSTNPYVPRFVEVCTDIVDAHGLQTVGIYRVPGNNASIVAL
IDEINRNYEEVPVDDPRWNDLHVVSSLLKAFFRKIPDSLVTSALYPSFIKADKIENPEAR
MKELKRLIKSLPPHNYHTLKHIMFHLKKVMDNSEINKMEAKNLAIVFGPNIVRPEDDNME
TMVSNMTHQYKIVETLLTSADWFFSDDDTDEVPLSAVITEAQDEPEPPSSQALLLENISK
YEALKDKQKNGALLSSIISAAQRKVKRKTTKGSGSLSESKEVTSPNGTGGYYSDTFSQSD
LKNSTITDDKSNVIPTTVSEIEKSCKQPAKVPWFNYSTDKEDFHRRIENFKQETEAMLQM
PRHLEISVTNIASKSTSASNVNQTPRLSTRTVDSHLLKTNSASNVFTRTINMDNRHSLDN
SYQVQYNKNNSDFGGSLRDTNRNESVSTQNGRLVRRGSSVENVNSSSMDLNANGAMKKVK
YENEGGSLDSLHKEVSIDDDADLVTTLTNLYDKKLMEKKNSRENLLSGEDFPYADESPEK
THRIIAHSLSDKENVPNLGDCYRNPSLHKNQFSNKANFLHWDDSKLKESKNDTEKDEDST
MTSEKHISNKHMNNRKNSVPNSKLRRSESLNKPERTVSPLNNKLKRSESLNKTGDKLKRS
DSLTKTEKTESNLNKRRELATSVRRSKDVTKLKRKNGMPDRSIKRRHTVGGTKDPDKVTW
LDNKYQEEVTSNKENKEKNLRTSSPDLSSTRRERLFFEINLIGPENMVVALKQHLMGARP
QSFPETAVFKVPLESHV
Download sequence
Identical sequences TC012615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]