SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC012975 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC012975
Domain Number 1 Region: 555-731
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.45e-62
Family Reverse transcriptase 0.00054
Further Details:      
 
Domain Number 2 Region: 936-1092
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.79e-32
Family Retroviral integrase, catalytic domain 0.0082
Further Details:      
 
Domain Number 3 Region: 326-423
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000901
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 
Domain Number 4 Region: 264-306
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000117
Family Retrovirus zinc finger-like domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC012975
Sequence length 1236
Comment GLEAN_12975
Sequence
MGRHRYRGNVDSDDSDSSDDEPRPKRSAPGVSTTVNSPPVSAESARIARLEQLVENLNRR
LLNRNFEHTSGQVGIKSGLIPEFAPGNPNFSTTKWLHKIDQLALVNGWDERTTIYGMISR
LKGLAKEWYDNLDPSAYDRSWDEWKRLLQATFPDHHDYASTLRKLVNRVKEDGETWAQYY
FGKLNLLQACDITGTNAVSCLIDGITDVTLRNGARAGRYVTPESLYAEYLSTLRSEGDKR
DTLAKQAPRERRRFLPSRVEAQKLYSSVRCYNCRNRGHVATKCPKPRIECKKCGRIGHVD
AECRRGNVVKENMSKQALTTSVADASNNKNYYIDIKVNGKPTRAYIDSGAEPVLVKQSVA
RELGLMWQPSLHLIRGYGQGITKVHGEVEVELEVDLVKANVKALIVEDSAQRVPVIVGQT
FLNAGANTIIANEEAVRVVDGNNESIQAFLGQLPTRKVALWAEDETVIPPQSIGCIRIKA
KDDGWKGAYYVEGCQRPRPGFEHVVHRCVTCDGGLVTVRNLSHQDLVYRKAQIVARAEPC
EQEWTATTFEQLLQLVNEFRDCFARNVAEIGATTAAEMKLTLTDDKPVVYRPYRLSHHER
RIVRDIVNDLLGSGVIRESDSPYSSPILLVRTKDGQHRMCVDYRQLNSKTIKDRFPLPRV
DEHLDKLNGAKFFTTLDLASGYYQIPMATESIPKTAFVTPDGHYEFVRMPFGLANAPAVF
QRAMNKPTDDQRGTKVPLVRARNASGDCNALRTTLTKRDLIPRIGRWWLLTSEFDFTVEY
RPGSKMSHVDALSRNPVLDPSEPSVEVLHINVNDDDWILAVQMKDARCALLKEILEKSPT
NAEERAIHKEYKLKDGRVFKQTESGLKWVVPKAVRRQILLAHHDGIGHLSNEKTLASVSK
SYWFPSMRRYVHKYISSCLECLYNKEAGGKQPGFLNPIPKNAQPFDTLHMDHLGPFVKSK
SHNSYLLAIIDAFTKFVFLRAVPNTKVGPVLSFLASLTGMFGVPKRIIADRGACFSSKKF
KTHCTDLNVKLVLTATATSRANGQVERLNRTILSQLAASSREEEKWDDFVSRISWGINST
PNSTTGKSPYELLLGYTPRHANDSILTNVVTEGVHDGDLPRTRADVAQRVEKEQQKQKER
YDKRRCAPKRFNAGDLVLVRTTRASNEGKSRKLLPKYSGPYRIQKVLDYDRYVVTDMPGA
TRSQKRYEGVHSVDKLRHYVVATTSGDETIGDVSDE
Download sequence
Identical sequences TC012975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]