SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC013303 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC013303
Domain Number 1 Region: 22-131
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-28
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 195-290
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.55e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00022
Further Details:      
 
Weak hits

Sequence:  TC013303
Domain Number - Region: 349-446
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00327
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC013303
Sequence length 454
Comment GLEAN_13303
Sequence
MPPPGIDNKNSRLLNYEENLQIFRLLGNRCQSLCTTVAQLFCTEPPIHSQWIKKDVGVLC
FVKDNSRKNYFFRLFCLKRNMMVWEQEMYKNMEYNDSTLFLHIFEGEDMMVAFNFASTDE
AKEFKAVVDEKLMVRRKREERRQKQMRTPTSQQNNIVNSNTLRAPHDYRKVSDPVVKQAK
RKRNITKADIGVPLDFKHISHVGWNPDSGFDIDSQDEQLKCFFEKAGISEKQLQDRDTKE
FIYDFINKHGGREAIEESTSRHSARKAPALPPFTQAPPVPPVPPRGPLRSHASSHRVAPP
PPPAPASITNSVENEKVIPPPPPPLADLEAVPPPPVPAFDLSQGDGPIPPPPAMGSALLD
SIKTGTTLRPVEERKMPTTPVVEDSRGQLMKEIQKGLKLKPVCERDVKPVNNVVETRSGD
LAEALARALAERSKAIHSEDDDDEEDSNDDEWED
Download sequence
Identical sequences 7070.XP_970859 TC013303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]