SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC013394 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC013394
Domain Number 1 Region: 17-250
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-64
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 302-385
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000016
Family SH3-domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC013394
Sequence length 386
Comment GLEAN_13394
Sequence
MDFNVKKIVKDAGAAISRVVQMTEEKLGTSEKTELDAHFENLWERAENTKNWTEKIVRDA
EAVLIPNPGNRIEDFIYEKIDKKRPSRLSNLEYLGLDMIEAGNVYGPGTAYGSCLIKVGQ
WEQKLGQNERDFIGSAAMCFTQPMRKFLDTEIKTILKEKNLLEVKRLDLDACKNRVRKAR
SMLGQPAAERDLRIAQSEFDRQAEITKLLLEGIGSSHAAHLRCLQEFVETQARFYSQCTT
IMTDLQRELASSVKPGPVLRLNSEDLEPVVPNNTRVSSPAAFTPVIITSSDDSEYSVLMS
SMPGVDPNSPVNPKPNEWNNEVPNNGMRKARVIYDYDGQDTTELSLMANEIIMVKELSDK
PNEDYLYGERGHQKGKVPRAYLEFIS
Download sequence
Identical sequences TC013394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]