SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC014100 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC014100
Domain Number 1 Region: 160-468
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.75e-40
Family NodB-like polysaccharide deacetylase 0.016
Further Details:      
 
Domain Number 2 Region: 57-98
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000183
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 114-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC014100
Sequence length 534
Comment GLEAN_14100
Sequence
MALKQGALFILAICACTVFAQQQAEETAPKKEDSFEVELCKDKDAGEWFRLVAGEGDNCR
DVIQCTSSGLQAIRCPAGLYFDIDKQTCDWKDSVKNCKLKNKERKVKPLLITDEPLCPDG
SLACGDGNCIERGLFCNGEKDCSDGSDENTCDIDNDPNRAPPCDPAVCVLPDCFCSEDGT
TIPGDLPSKDVPQMITITFDDAINNNNIELYKEIFNGKRKNPNGCDIKATFFVSHKYTNY
SAVQEMHRKGHEIAVHSITHNDDERFWSNATVDDWAKEMAGMRIIAEKFANLTDNSVVGV
RAPYLRVGGNNQFTMMEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNLQSCPTRS
HAVWEMVLNELDRREDPTNDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHYEENRAPL
GLYFHAAWLKNNPEFLDAFLYWVDEILANHNDVYFVTMTQVIQWIQNPRTITESKNFEPW
REKCVVEGNPHCWVPHSCKLTSKEVPGETINLQTCVRCPNNYPWVNDPTGDGFF
Download sequence
Identical sequences A7U8C9
TC014100 NP_001095946.1.52716 7070.A7U8C9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]