SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC014698 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC014698
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Kelch motif 7.72e-44
Family Kelch motif 0.0089
Further Details:      
 
Domain Number 2 Region: 661-710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000628
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 3 Region: 573-715
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000235
Family Growth factor receptor domain 0.0089
Further Details:      
 
Weak hits

Sequence:  TC014698
Domain Number - Region: 753-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Laminin-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC014698
Sequence length 1162
Comment GLEAN_14698
Sequence
MFGGYSLSHGPLNDIRLFDTRNSTWMQVTVDSTTPDAKMPQGRYFHGADIIYSKQAIYVY
GGLTKPVKASNNRTLDDFWQFDIQNQRWGEIEKSNEWPPPLSSHTLTSYRNSTSESLILI
GGISPQSDFHSVVWEFRLDKEQWQECRTKGQGPVGIFGHSTVFHAQTNSLYVFGGYIYES
QASRLSNKLYMLNYDTKTWTELNELGASLYLPRPRFFHSAVTTDNFMFVMGGRIFPWNIS
DTLYAYSYNCNRWINLMSEALEKVGPLPIQTYAQAMTIEPDGDAAYIVGGWGSDSQCSVL
RLELPEDLCSLWPTRDSCFRMAGCGYCAYKVGEEVMSEVCHSNAKECPLQDSPANASKIS
NPGTVCNEPVVSRNCSSMTDCASCVKIGCRFCENTCTSNATCPVDTLTECFPNNCSAKNY
ENCRQTPGCDWNCSKGECVPLLKGQEPNPKPCPQSCMHYNTCASCLETVHCRWSTQLDEC
ISALYQPAYCAGGVCGLVLQADDKQYCPAPCSSFSQCSHCLRHAHCGWCAGPGNGDGVCT
EGSNERPMHGTCNDIFMKENPNEDLQNVTSTWHYVRCPEEDECTNGHHNCEAESQRCVDK
PQGFECECGPGYKAASSTKLSTGSTVCEPVCLLGCVRGQCVQPNKCQCDFGYVGANCSIQ
CQCNGHANCEGPDKLDKCLTCYNNTMGAQCEKCKPLFVGDPSDGGQCVPCLEYCHGHTPI
CVDNSTDVDFIDFIDYESERFLKNIKEGPKAFAKCLKCTNQTAGPRCEDCIVGNFRGTED
HRDPCRPCDCHGHGDTCDPVTGDKCNCKNNTESDACGGSGKNSAHPCWMVQCSKCKEGYL
GTPTSGHQCYKQMAVESKMCFDAKPIDECKIKPKPLHPGEMVFFVIQPRFMNVDIRIIID
VTQGNLNVYMSTHDDTYVAYPNSTTGLNTIDLDAQYSHWENGSQKIRDAFLEHEAVGLHT
YITITQPNTILAVKNLRDRLVITLPEEYHSLESTRFFLVLQALDPGDSEKKVAYGIVFSR
QDQLHIDLFVFFSVFFSCFFLFLAACVVAWKAKQAADVRRARRRHVVEMLHMAKRPFASV
TLNLSTRAKPKKSAHCDLRPVAVEPTDDGLAAVATVFVSLPGGQSPCVKLALASSLILLV
RQFPTGGRTFLRRRSAHAAPPT
Download sequence
Identical sequences A0A139WHN9
TC014698 7070.XP_001814936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]