SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC030600 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC030600
Domain Number 1 Region: 26-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.57e-57
Family BAR domain 0.0000000582
Further Details:      
 
Domain Number 2 Region: 283-350
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-17
Family SH3-domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC030600
Sequence length 351
Comment GLEAN_00633-OG13139
Sequence
MAESRGSLLAKSVQKHAGRAKEKILQNLGKVDRTADEIFDEHLQNFTRQQNAANRIQKEF
NNYIRCIRAAQAASKSLLEAIGETYESQWTGHDLLYVQTQQIDMLWQDFSHKLADQVLLP
LNTYQSQFPEMRKKIDKRGRKLVDFDSQRHSFQALQTNMKKRDDAKIAKGREQLEEAKRT
YEMLNSELHDELPALYDSRILFYVTNLQSLFNAEHVFHSEASKIYGELESVVDKLATDSQ
RGSYSLKKTNGSSLPRPADKNSSPLIINNISPISSPHRASTDNLPPGVLYRVKATYKYNR
EDVDELSFDVGEIIQVVEYDDPEEQEEGWLMGLKENTGEKGMFPANFTRPL
Download sequence
Identical sequences TC030600 XP_008195230.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]