SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|57640078|ref|YP_182556.1| from Thermococcus kodakarensis KOD1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57640078|ref|YP_182556.1|
Domain Number 1 Region: 13-43
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000645
Family Classic zinc finger, C2H2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|57640078|ref|YP_182556.1|
Sequence length 47
Comment nucleic acid-binding protein, containing C2H2 zinc-finger [Thermococcus kodakarensis KOD1]
Sequence
MAVLKAIKIEDRDGEILFRCPRCGMVFRSAKAYTRHVNKAHGHLFRK
Download sequence
Identical sequences A0A142CU27 Q5JFH3
gi|57640078|ref|YP_182556.1| WP_011249098.1.23727 WP_011249098.1.7426 69014.TK0143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]